CDCP1 Antibody (HRP)

Catalog number KH-4011-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KH-4011-01

Size / count 50 μL

Specifications

Catalog number: KH-4011-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: CUB domain-containing protein 1, Membrane glycoprotein gp140, Subtractive immunization M plus HEp3-associated 135 kDa protein, SIMA135, Transmembrane and associated with src kinases, CD antigen CD318
Gene Name: CDCP1
Gene ID: 64866
UniProt: Q9H5V8
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CDCP1
Target Antigen: CD318
Target: PP-1224
Partner Proteins: CUB domain-containing protein 1; Membrane glycoprotein gp140; Subtractive immunization M plus HEp3-associated 135 kDa protein; SIMA135; Transmembrane and associated with src kinases; CD antigen CD318
Clone: K1E008_11C7
Conjugation: Conjugated with peroxidase
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 76%, Pig - 78%, Cynomolgus monkey - 94%
Purity: ≥85%
Cores: GPAVGIYNDNINTEMPRQPKKFQKGRKDNDSHVYAVIEDTMVYGHLLQDSSGSFLQPEVDTYRPFQGTMGVCPPSPPTICSRAPTAKLATEEPPPRSPPESESEPYTFSHPNNGDVSSKD
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 76%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:250~1:500
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: TRASK
Target Alternative Name: CDCP1
Panel Description: CD Antigen
Host or Source: Mouse
Protein Name: CUB domain containing protein 1
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for CDCP1 Antibody (HRP)?

The catalog number for CDCP1 Antibody (HRP) is KH-4011.

What sizes are available for CDCP1 Antibody (HRP)?

CDCP1 Antibody (HRP) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does CDCP1 Antibody (HRP) come in?

CDCP1 Antibody (HRP) is available in 3 different pack sizes.

Is CDCP1 Antibody (HRP) in stock?

CDCP1 Antibody (HRP) is currently made to order / not held in immediate stock. Contact us for lead time.

What is the recommended positive control for this assay?

A recommended positive control, where one is specified by the manufacturer, is listed on the datasheet or in the assay protocol.

How should this product be stored?

Storage conditions depend on the specific reagent and are listed on the product datasheet, with most antibodies and proteins requiring -20°C unless stated otherwise. It is your responsibility to store the product correctly immediately upon receipt; damage from improper storage after delivery is not eligible for replacement.

Is this product animal-origin-free?

Animal-origin-free status, where applicable, is noted on the datasheet under formulation details.

All Products