NCOR1P1 Antibody (Biotin)

Catalog number KB-3609-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-3609-01

Size / count 50 μL

Specifications

Catalog number: KB-3609-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Putative nuclear receptor corepressor 1-like protein NCOR1P1, Nuclear receptor corepressor 1 pseudogene 1
Gene Name: NCOR1P1
Gene ID: 149934
UniProt: Q9H4R4
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human NCOR1P1
Target: PP-9886
Partner Proteins: Putative nuclear receptor corepressor 1-like protein NCOR1P1; Nuclear receptor corepressor 1 pseudogene 1
Clone: K8U019_4G12
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 83%, Pig - 87%, Cynomolgus monkey - 87%
Purity: ≥85%
Cores: PPHSVKYTFPSTHHQQDPAFGGKHEAPSSPILGQPCGDDQNASPSKLSKEELIECMDRVDREIAKVEQQILKLKKKQVKV
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 83%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:250~1:500
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: C20orf191
Target Alternative Name: NCOR1P1
Host or Source: Mouse
Protein Name: NCOR1 pseudogene 1
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for NCOR1P1 Antibody (Biotin)?

The catalog number for NCOR1P1 Antibody (Biotin) is KB-3609.

What sizes are available for NCOR1P1 Antibody (Biotin)?

NCOR1P1 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does NCOR1P1 Antibody (Biotin) come in?

NCOR1P1 Antibody (Biotin) is available in 3 different pack sizes.

Is NCOR1P1 Antibody (Biotin) in stock?

NCOR1P1 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

How many freeze-thaw cycles can this product tolerate?

We recommend aliquoting the product upon receipt to avoid repeated freeze-thaw cycles, which can reduce activity and stability. This is your responsibility once the product has been delivered.

Is antigen retrieval required for IHC with this antibody?

Recommended antigen retrieval methods, where applicable, are listed on the datasheet under the IHC protocol section.

What temperature does this product ship at?

Shipping temperature is chosen based on the product’s stability needs, ranging from ambient to dry ice, and is indicated on the product page. Any related shipping fee is shown clearly in your quotation.

All Products