SMOC2 Antibody (Biotin)

Catalog number KB-7819-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-7819-01

Size / count 50 μL

Specifications

Catalog number: KB-7819-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: SPARC-related modular calcium-binding protein 2, Secreted modular calcium-binding protein 2, SMOC-2, Smooth muscle-associated protein 2, SMAP-2
Gene Name: SMOC2
Gene ID: 64094
UniProt: Q9H3U7
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human SMOC2
Target: PP-973
Partner Proteins: SPARC-related modular calcium-binding protein 2; Secreted modular calcium-binding protein 2; SMOC-2; Smooth muscle-associated protein 2; SMAP-2
Clone: K29033_1D4
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 97%, Rat - 53%, Pig - 94%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: DDAAAPALETQPQGDEEDIASRYPTLWTEQVKSRQNKTNKNSVSSCDQEHQSALEEAKQPKNDNVVIPECAHGGLYKPVQCHPSTGYCWCVLVDTGRPIPGTSTRYEQPKCDNTARAHPAKARDLYKGRQLQGCPGAKKH
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 97%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: SMAP2
Target Alternative Name: SMOC2
Host or Source: Mouse
Protein Name: SPARC related modular calcium binding 2
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2b

Frequently Asked Questions

What is the catalog number for SMOC2 Antibody (Biotin)?

The catalog number for SMOC2 Antibody (Biotin) is KB-7819.

What sizes are available for SMOC2 Antibody (Biotin)?

SMOC2 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does SMOC2 Antibody (Biotin) come in?

SMOC2 Antibody (Biotin) is available in 3 different pack sizes.

Is SMOC2 Antibody (Biotin) in stock?

SMOC2 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product covered by a money-back guarantee?

Yes, we guarantee a full refund or store credit if this product arrives damaged beyond usability, or has a genuine performance issue under proper usage and storage, provided you report it immediately with evidence. Claims after the expiration date or due to improper storage after receipt are excluded.

Can this product be used for diagnostic or therapeutic purposes?

No. This product, like all items we supply, is intended for research laboratory use only and must not be used for diagnostics, therapeutics, treatment, or consumption by humans or animals.

What is the shelf life of this product?

Shelf life and expiration dates vary by product and are shown on the product listing and label. Products used beyond their expiration date are not eligible for performance-related returns or refunds, so please check the lot number and expiry before use.

All Products