GBA3 Antibody (Biotin)

Catalog number KB-7293-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-7293-01

Size / count 50 μL

Specifications

Catalog number: KB-7293-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Cytosolic beta-glucosidase, Cytosolic beta-glucosidase-like protein 1, Cytosolic galactosylceramidase, Cytosolic glucosylceramidase, Cytosolic glycosylceramidase, Cytosolic GCase, Glucosidase beta acid 3, Glucosylceramidase beta 3, Klotho-related protein, KLrP
Gene Name: GBA3
Gene ID: 57733
UniProt: Q9H227
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human GBA3
Target: PP-10680
Partner Proteins: Cytosolic beta-glucosidase; Cytosolic beta-glucosidase-like protein 1; Cytosolic galactosylceramidase; Cytosolic glucosylceramidase; Cytosolic glycosylceramidase; Cytosolic GCase; Glucosidase beta acid 3; Glucosylceramidase beta 3; Klotho-related protein; KLrP
Clone: K8U013_13H4
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 37%, Rat - 41%, Pig - 90%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: EEEKKMIKGTADFFAVQYYTTRLIKYQENKKGELGILQDAEIEFFPDPSWKNVDWIYVVPWGVCKLLKYIKDTYNNPVIYITENGFPQSDPAPLDDTQRWEYFRQTFQELFKAIQLDKVNLQVYCAWSLLDNFEWNQGYSSRFGLFHVDF
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 37%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: CBG; CBGL1
Target Alternative Name: GBA3
Host or Source: Mouse
Protein Name: Glucosylceramidase beta 3 (gene/pseudogene)
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for GBA3 Antibody (Biotin)?

The catalog number for GBA3 Antibody (Biotin) is KB-7293.

What sizes are available for GBA3 Antibody (Biotin)?

GBA3 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does GBA3 Antibody (Biotin) come in?

GBA3 Antibody (Biotin) is available in 3 different pack sizes.

Is GBA3 Antibody (Biotin) in stock?

GBA3 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

How do I reconstitute this lyophilized product?

Reconstitution instructions, including the recommended diluent and final concentration, are provided on the datasheet. Aliquot immediately after reconstitution to avoid repeated freeze-thaw cycles.

What is the recommended incubation time for this antibody?

A suggested incubation time is provided in the recommended protocol on the datasheet, but may need adjusting depending on your sample type and detection system.

What should I check when this product first arrives?

Inspect the package immediately for transportation damage, ice loss, leakage, or breakage. Report any issues right away with photos and your order reference; our specialists will determine whether the product is still usable or needs replacing.

All Products