MEGF9 Antibody (Biotin)

Catalog number KB-26666-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-26666-01

Size / count 50 μL

Specifications

Catalog number: KB-26666-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Multiple epidermal growth factor-like domains protein 9, Multiple EGF-like domains protein 9, Epidermal growth factor-like protein 5, EGF-like protein 5
Gene Name: MEGF9
Gene ID: 1955
UniProt: Q9H1U4
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human MEGF9
Target: PP-1501
Partner Proteins: Multiple epidermal growth factor-like domains protein 9; Multiple EGF-like domains protein 9; Epidermal growth factor-like protein 5; EGF-like protein 5
Clone: K29079_4B2
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 63%, Rat - 43%, Pig - 77%, Cynomolgus monkey - 69%
Purity: ≥85%
Cores: VTGGGGAAGQVDASPGPGLRGEPSHPFPRATAPTAQAPRTGPPRATVHRPLAATSPAQSPETTPLWATAGPSSTTFQAPLGPSPTTPPAAERTSTTSQAPTRPAPTTLSTTTGPAPTTPVATTVPAPTTPRTPTPDLPSSSNSSVLPTPPATEAPSSPPPEYVCNCSVVGSLNVNRCNQTTGQCECRPGYQGLHCETCKEGFYLNYTSGL
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 63%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: EGFL5; KIAA0818
Target Alternative Name: MEGF9
Host or Source: Mouse
Protein Name: Multiple EGF like domains 9
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for MEGF9 Antibody (Biotin)?

The catalog number for MEGF9 Antibody (Biotin) is KB-26666.

What sizes are available for MEGF9 Antibody (Biotin)?

MEGF9 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does MEGF9 Antibody (Biotin) come in?

MEGF9 Antibody (Biotin) is available in 3 different pack sizes.

Is MEGF9 Antibody (Biotin) in stock?

MEGF9 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

What is the difference between this product and a similar catalogue number?

Differences typically involve clone, conjugate, host species, or validated applications. Compare the respective datasheets, or contact us with both catalogue numbers for a direct comparison.

Do you offer custom or private-label production of this type of product?

Yes, custom antibody development and private-label production services are available. Contact our sales team to discuss your target, timeline, and quantity requirements.

What is the immunogen used to generate this antibody?

Immunogen or antigen details used to raise this antibody are listed on the product datasheet under immunogen information.

All Products