ATG10 Antibody (Biotin)

Catalog number KB-7523-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-7523-01

Size / count 50 μL

Specifications

Catalog number: KB-7523-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Ubiquitin-like-conjugating enzyme ATG10, Autophagy-related protein 10, APG10-like
Gene Name: ATG10
Gene ID: 83734
UniProt: Q9H0Y0
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human ATG10
Target: PP-10672
Partner Proteins: Ubiquitin-like-conjugating enzyme ATG10; Autophagy-related protein 10; APG10-like
Clone: K8U013_17F1
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 79%, Pig - 83%, Cynomolgus monkey - 95%
Purity: ≥85%
Cores: TFQRYCAEFIKHSQQIGDSWEWRPSKDCSDGYMCKIHFQIKNGSVMSHLGASTHGQTCLPMEEAFELPLDDCEVIETAAASEVIKYEYHVLYSCSYQVPVLYFRASFLDGRPLTLKDIWEGVHECYKMRLLQGPWDTITQQEHPILGQPFFVLHPCKTNEFMTPVLKNSQKINKNVNYIT
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 79%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: APG10L
Target Alternative Name: ATG10
Host or Source: Mouse
Protein Name: Autophagy related 10
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for ATG10 Antibody (Biotin)?

The catalog number for ATG10 Antibody (Biotin) is KB-7523.

What sizes are available for ATG10 Antibody (Biotin)?

ATG10 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does ATG10 Antibody (Biotin) come in?

ATG10 Antibody (Biotin) is available in 3 different pack sizes.

Is ATG10 Antibody (Biotin) in stock?

ATG10 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

Do you offer bulk or custom quantities of this product?

Yes. Ordering two or more units, or combining this with other products, usually qualifies for a discount depending on quantity. Contact our sales team with your required volume for a custom quote.

Do you provide a Certificate of Analysis (CoA) for this product?

A Certificate of Analysis is available for most products upon request. Contact our support team with the lot number to obtain the relevant CoA.

Is this product suitable for live cell imaging?

Suitability for live cell imaging depends on the specific reagent and conjugate used. Check the datasheet for imaging-specific validation, or contact us for guidance.

All Products