GABARAP/GABARAPL1 Antibody

Catalog number KC-35516-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-35516-01

Size / count 50 μL

Specifications

Catalog number: KC-35516-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Gamma-aminobutyric acid receptor-associated protein-like 1, Early estrogen-regulated protein, GABA (A) receptor-associated protein-like 1, Glandular epithelial cell protein 1, GEC-1
Gene Name: GABARAPL1
Gene ID: 23710
UniProt: Q9H0R8
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human GABARAPL1
Target: PP-4561
Partner Proteins: Gamma-aminobutyric acid receptor-associated protein-like 1; Early estrogen-regulated protein; GABA (A) receptor-associated protein-like 1; Glandular epithelial cell protein 1; GEC-1
Clone: K29109_4E6
Conjugation: Unconjugated
Applications: WB
Validation: WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 100%, Rat - 100%, Pig - 99%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 100%
Recombinant Antibody: Not recombinant
WB Dilution: 1:250~1:500
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: GEC1
Target Alternative Name: Recognizing both GABARAP and GABARAPL1 but not GABARAPL2 with an epitope within the aa21-117 region of GABARAPL1
Panel Description: Ferroptosis
Host or Source: Mouse
Protein Name: GABA type A receptor associated protein like 1
WB Description: Succeed
IHC description: Fail (Heart Muscle)
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for GABARAP/GABARAPL1 Antibody?

The catalog number for GABARAP/GABARAPL1 Antibody is KC-35516.

What sizes are available for GABARAP/GABARAPL1 Antibody?

GABARAP/GABARAPL1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does GABARAP/GABARAPL1 Antibody come in?

GABARAP/GABARAPL1 Antibody is available in 3 different pack sizes.

Is GABARAP/GABARAPL1 Antibody in stock?

GABARAP/GABARAPL1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What host species was used to raise this antibody?

The host species used in production is listed under product specifications on the datasheet, and is relevant when selecting a compatible secondary antibody for your assay.

What is the difference between this product and a similar catalogue number?

Differences typically involve clone, conjugate, host species, or validated applications. Compare the respective datasheets, or contact us with both catalogue numbers for a direct comparison.

Do you offer custom or private-label production of this type of product?

Yes, custom antibody development and private-label production services are available. Contact our sales team to discuss your target, timeline, and quantity requirements.

All Products