WWP1 Antibody (Biotin)

Catalog number KB-8172-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-8172-01

Size / count 50 μL

Specifications

Catalog number: KB-8172-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: NEDD4-like E3 ubiquitin-protein ligase WWP1, Atrophin-1-interacting protein 5, AIP5, HECT-type E3 ubiquitin transferase WWP1, TGIF-interacting ubiquitin ligase 1, Tiul1, WW domain-containing protein 1
Gene Name: WWP1
Gene ID: 11059
UniProt: Q9H0M0
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human WWP1
Target: PP-8967
Partner Proteins: NEDD4-like E3 ubiquitin-protein ligase WWP1; Atrophin-1-interacting protein 5; AIP5; HECT-type E3 ubiquitin transferase WWP1; TGIF-interacting ubiquitin ligase 1; Tiul1; WW domain-containing protein 1
Clone: K24023_18C6
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 77%, Pig - 84%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: KLERVKEQLKLSLENKNGIAQTGELTVVLDGLVIEQENITNCSSSPTIEIQENGDALHENGEPSARTTARLAVEGTNGIDNHVPTSTLVQNSCCSYVVNGDNTPSSPSQVAARPKNTPAPKPLASEPADDTVNGESSSFAPTDNASVTGT
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 77%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: WWP1
Panel Description: E3 Ligase, Ubiquitin-Proteasome System
Host or Source: Mouse
Protein Name: WW domain containing E3 ubiquitin protein ligase 1
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for WWP1 Antibody (Biotin)?

The catalog number for WWP1 Antibody (Biotin) is KB-8172.

What sizes are available for WWP1 Antibody (Biotin)?

WWP1 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does WWP1 Antibody (Biotin) come in?

WWP1 Antibody (Biotin) is available in 3 different pack sizes.

Is WWP1 Antibody (Biotin) in stock?

WWP1 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

What buffer is this product supplied in?

The formulation or storage buffer is listed on the product datasheet. If you require a carrier-free or custom formulation, contact us before ordering, as this may involve a made-to-order production timeline.

What dilution range is recommended for immunohistochemistry (IHC) with this antibody?

A starting IHC dilution range is listed on the datasheet, but should be optimized for your specific tissue type and staining protocol.

Can I request a Safety Data Sheet (SDS) for this product?

Yes, safety data sheets are available for hazardous or chemically classified products and can be provided on request or downloaded from the product page.

All Products