LAT2 Antibody (Biotin)

Catalog number KB-3530-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-3530-01

Size / count 50 μL

Specifications

Catalog number: KB-3530-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Linker for activation of T-cells family member 2, Linker for activation of B-cells, Membrane-associated adapter molecule, Non-T-cell activation linker, Williams-Beuren syndrome chromosomal region 15 protein, Williams-Beuren syndrome chromosomal region 5 protein
Gene Name: LAT2
Gene ID: 7462
UniProt: Q9GZY6
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human LAT2
Target: PP-971
Partner Proteins: Linker for activation of T-cells family member 2; Linker for activation of B-cells; Membrane-associated adapter molecule; Non-T-cell activation linker; Williams-Beuren syndrome chromosomal region 15 protein; Williams-Beuren syndrome chromosomal region 5 protein
Clone: K52022_8E6
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 43%, Rat - 46%, Pig - 47%, Cynomolgus monkey - 88%
Purity: ≥85%
Cores: WGRFSKPPEDDDANSYENVLICKQKTTETGAQQEGIGGLCRGDLSLSLALKTGPTSGLCPSASPEEDEESEDYQNSASIHQWRESRKVMGQLQREASPGP
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 43%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:250~1:500
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: LAB; NTAL; WBS15; WBSCR15; WBSCR5
Target Alternative Name: LAT2
Host or Source: Mouse
Protein Name: Linker for activation of T cells family member 2
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for LAT2 Antibody (Biotin)?

The catalog number for LAT2 Antibody (Biotin) is KB-3530.

What sizes are available for LAT2 Antibody (Biotin)?

LAT2 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does LAT2 Antibody (Biotin) come in?

LAT2 Antibody (Biotin) is available in 3 different pack sizes.

Is LAT2 Antibody (Biotin) in stock?

LAT2 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

How long will it take to receive this product if it’s custom made?

Lead times depend on the product type: custom polyclonal antibodies typically take 12-14 weeks, monoclonal antibodies 15-17 weeks, made-to-order recombinant proteins 4-8 weeks, and made-to-order recombinant antibodies 6-8 weeks. These are estimates and may shift due to production delays.

What is the recommended dilution for this antibody?

A recommended dilution range for each validated application is provided on the datasheet, but optimal dilution should be titrated for your specific experimental system, sample type, and detection method.

What is the recommended storage temperature after reconstitution?

Post-reconstitution storage guidance is listed on the datasheet, typically requiring aliquoting and storage at -20°C or -80°C to preserve activity.