PDGFD Antibody (Biotin)

Catalog number KB-3596-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-3596-01

Size / count 50 μL

Specifications

Catalog number: KB-3596-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Platelet-derived growth factor D, PDGF-D, Iris-expressed growth factor, Spinal cord-derived growth factor B, SCDGF-B) [Cleaved into: Platelet-derived growth factor D, latent form, PDGFD latent form, Platelet-derived growth factor D, receptor-binding form, PDGFD receptor-binding form]
Gene Name: PDGFD
Gene ID: 80310
UniProt: Q9GZP0
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human PDGFD
Target: PP-1223
Partner Proteins: Platelet-derived growth factor D; PDGF-D; Iris-expressed growth factor; Spinal cord-derived growth factor B; SCDGF-B) [Cleaved into: Platelet-derived growth factor D; latent form; PDGFD latent form; Platelet-derived growth factor D; receptor-binding form; PDGFD receptor-binding form]
Clone: K8U018_7F10
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 87%, Rat - 85%, Pig - 91%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: TNWESVTSSISGVSYNSPSVTDPTLIADALDKKIAEFDTVEDLLKYFNPESWQEDLENMYLDTPRYRGRS
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 87%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:250~1:500
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: IEGF; SCDGFB
Target Alternative Name: PDGFD
Panel Description: Cytokines
Host or Source: Mouse
Protein Name: Platelet derived growth factor D
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for PDGFD Antibody (Biotin)?

The catalog number for PDGFD Antibody (Biotin) is KB-3596.

What sizes are available for PDGFD Antibody (Biotin)?

PDGFD Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does PDGFD Antibody (Biotin) come in?

PDGFD Antibody (Biotin) is available in 3 different pack sizes.

Is PDGFD Antibody (Biotin) in stock?

PDGFD Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

Can I return this product if I ordered the wrong one?

As a consumer, you have a 14-day right of withdrawal from receipt under EU consumer protection law, submitted via our withdrawal/cancellation request form. Note this applies to unused, undamaged products, and doesn’t override the expiry/storage conditions on performance-based claims.

Is this product tested for endotoxin levels?

Endotoxin testing status is noted on the datasheet where applicable, particularly for recombinant proteins intended for cell-based or functional assays. If this isn’t listed and you need confirmation, contact support with the catalogue number.

Can I request additional validation data, such as western blot images, for this product?

Additional data may be available on request. Contact our technical support team with the catalogue number and we’ll check what supporting documentation the supplier can provide.