TRIM31 Antibody (Biotin)

Catalog number KB-16160-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-16160-01

Size / count 50 μL

Specifications

Catalog number: KB-16160-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: E3 ubiquitin-protein ligase TRIM31, Tripartite motif-containing protein 31
Gene Name: TRIM31
Gene ID: 11074
UniProt: Q9BZY9
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human TRIM31
Target: PP-2732
Partner Proteins: E3 ubiquitin-protein ligase TRIM31; Tripartite motif-containing protein 31
Clone: K56017_15B3
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 52%, Rat - 29%, Pig - 52%, Cynomolgus monkey - 29%
Purity: ≥85%
Cores: KDHKSHNVSLIEEAAQNYQGQIQEQIQVLQQKEKETVQVKAQGVHRVDVFTDQVEHEKQRILTEFELLHQVLEEEKNFLLSRIYWLGHEGTEAGKHYVASTEPQLNDLKKLVDSLKTKQNMPPRQLLEDIKVVLCRSEEFQFLNPTPVPLELEKKLSEAKSRHDSITGSLKKFKDQLQADRKKDENRFFKSMNKNDMKSWGLLQKNNHKMNKTSEPGSSSAGGRTTSGPPNHHSSAPSHSLFRASSAGKVTFPVCLLASYDEISGQGASS
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 52%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: C6orf13; RNF
Target Alternative Name: TRIM31
Panel Description: E3 Ligase, Ubiquitin-Proteasome System
Host or Source: Mouse
Protein Name: Tripartite motif containing 31
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2b

Frequently Asked Questions

What is the catalog number for TRIM31 Antibody (Biotin)?

The catalog number for TRIM31 Antibody (Biotin) is KB-16160.

What sizes are available for TRIM31 Antibody (Biotin)?

TRIM31 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does TRIM31 Antibody (Biotin) come in?

TRIM31 Antibody (Biotin) is available in 3 different pack sizes.

Is TRIM31 Antibody (Biotin) in stock?

TRIM31 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

What is the difference between this product and a similar catalogue number?

Differences typically involve clone, conjugate, host species, or validated applications. Compare the respective datasheets, or contact us with both catalogue numbers for a direct comparison.

Do you offer custom or private-label production of this type of product?

Yes, custom antibody development and private-label production services are available. Contact our sales team to discuss your target, timeline, and quantity requirements.

What is the immunogen used to generate this antibody?

Immunogen or antigen details used to raise this antibody are listed on the product datasheet under immunogen information.

All Products