ACE2 Antibody (Biotin)

Catalog number KB-7246-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-7246-01

Size / count 50 μL

Specifications

Catalog number: KB-7246-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Angiotensin-converting enzyme 2, Angiotensin-converting enzyme homolog, ACEH, Angiotensin-converting enzyme-related carboxypeptidase, ACE-related carboxypeptidase, Metalloprotease MPROT15) [Cleaved into: Processed angiotensin-converting enzyme 2]
Gene Name: ACE2
Gene ID: 59272
UniProt: Q9BYF1
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human ACE2
Target: PP-376
Partner Proteins: Angiotensin-converting enzyme 2; Angiotensin-converting enzyme homolog; ACEH; Angiotensin-converting enzyme-related carboxypeptidase; ACE-related carboxypeptidase; Metalloprotease MPROT15) [Cleaved into: Processed angiotensin-converting enzyme 2]
Clone: K92008_6B8
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 77%, Rat - 76%, Pig - 74%, Cynomolgus monkey - 96%
Purity: ≥85%
Cores: IEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPDNPQECLLLEPGLNEIMANSLDYNE
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 77%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: ACE2
Host or Source: Mouse
Protein Name: Angiotensin converting enzyme 2
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for ACE2 Antibody (Biotin)?

The catalog number for ACE2 Antibody (Biotin) is KB-7246.

What sizes are available for ACE2 Antibody (Biotin)?

ACE2 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does ACE2 Antibody (Biotin) come in?

ACE2 Antibody (Biotin) is available in 3 different pack sizes.

Is ACE2 Antibody (Biotin) in stock?

ACE2 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

What buffer is this product supplied in?

The formulation or storage buffer is listed on the product datasheet. If you require a carrier-free or custom formulation, contact us before ordering, as this may involve a made-to-order production timeline.

What dilution range is recommended for immunohistochemistry (IHC) with this antibody?

A starting IHC dilution range is listed on the datasheet, but should be optimized for your specific tissue type and staining protocol.

Can I request a Safety Data Sheet (SDS) for this product?

Yes, safety data sheets are available for hazardous or chemically classified products and can be provided on request or downloaded from the product page.

All Products