RSPO3 Antibody (Biotin)

Catalog number KB-8035-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-8035-01

Size / count 50 μL

Specifications

Catalog number: KB-8035-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: R-spondin-3, Protein with TSP type-1 repeat, hPWTSR, Roof plate-specific spondin-3, hRspo3, Thrombospondin type-1 domain-containing protein 2
Gene Name: RSPO3
Gene ID: 84870
UniProt: Q9BXY4
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human RSPO3
Target: PP-967
Partner Proteins: R-spondin-3; Protein with TSP type-1 repeat; hPWTSR; Roof plate-specific spondin-3; hRspo3; Thrombospondin type-1 domain-containing protein 2
Clone: K16305_4F11
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 75%, Pig - 83%, Cynomolgus monkey - 96%
Purity: ≥85%
Cores: SEWNPWSPCTKKGKTCGFKRGTETRVREIIQHPSAKGNLCPPTNETRKCTVQRKKCQKGERGKKGRERKRKKPNKGESKEAIPDSKSLESSKEIPEQRENKQQQKKRKVQDKQKSVSVST
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 75%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: PWTSR; THSD2
Target Alternative Name: RSPO3
Host or Source: Mouse
Protein Name: R-spondin 3
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for RSPO3 Antibody (Biotin)?

The catalog number for RSPO3 Antibody (Biotin) is KB-8035.

What sizes are available for RSPO3 Antibody (Biotin)?

RSPO3 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does RSPO3 Antibody (Biotin) come in?

RSPO3 Antibody (Biotin) is available in 3 different pack sizes.

Is RSPO3 Antibody (Biotin) in stock?

RSPO3 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

What do I do if this product arrives with reduced ice or a damaged cold-chain package?

Report this to us immediately with photos and your order reference. Our specialists will assess whether the product is still usable given the cold-chain interruption, and will arrange a replacement or credit if it isn’t.

What host species was used to raise this antibody?

The host species used in production is listed under product specifications on the datasheet, and is relevant when selecting a compatible secondary antibody for your assay.

What is the difference between this product and a similar catalogue number?

Differences typically involve clone, conjugate, host species, or validated applications. Compare the respective datasheets, or contact us with both catalogue numbers for a direct comparison.