RSPO3 Antibody (Biotin)

Catalog number KB-8032-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-8032-01

Size / count 50 μL

Specifications

Catalog number: KB-8032-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: R-spondin-3, Protein with TSP type-1 repeat, hPWTSR, Roof plate-specific spondin-3, hRspo3, Thrombospondin type-1 domain-containing protein 2
Gene Name: RSPO3
Gene ID: 84870
UniProt: Q9BXY4
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human RSPO3
Target: PP-967
Partner Proteins: R-spondin-3; Protein with TSP type-1 repeat; hPWTSR; Roof plate-specific spondin-3; hRspo3; Thrombospondin type-1 domain-containing protein 2
Clone: K16305_16A12
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 75%, Pig - 83%, Cynomolgus monkey - 96%
Purity: ≥85%
Cores: SEWNPWSPCTKKGKTCGFKRGTETRVREIIQHPSAKGNLCPPTNETRKCTVQRKKCQKGERGKKGRERKRKKPNKGESKEAIPDSKSLESSKEIPEQRENKQQQKKRKVQDKQKSVSVST
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 75%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: PWTSR; THSD2
Target Alternative Name: RSPO3
Host or Source: Mouse
Protein Name: R-spondin 3
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for RSPO3 Antibody (Biotin)?

The catalog number for RSPO3 Antibody (Biotin) is KB-8032.

What sizes are available for RSPO3 Antibody (Biotin)?

RSPO3 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does RSPO3 Antibody (Biotin) come in?

RSPO3 Antibody (Biotin) is available in 3 different pack sizes.

Is RSPO3 Antibody (Biotin) in stock?

RSPO3 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

Does this product need any special customs documentation to be imported to my country?

If you’re outside the EU, UK, or USA, you’re responsible for customs clearance and any related taxes or fees. We provide the standard import documents, such as the Commercial Invoice, Packing List, and Airway Bill, in advance, so let us know early if your customs office needs anything additional for this specific product.

What buffer is this product supplied in?

The formulation or storage buffer is listed on the product datasheet. If you require a carrier-free or custom formulation, contact us before ordering, as this may involve a made-to-order production timeline.

What dilution range is recommended for immunohistochemistry (IHC) with this antibody?

A starting IHC dilution range is listed on the datasheet, but should be optimized for your specific tissue type and staining protocol.