GRASP65 Antibody (Biotin)

Catalog number KB-3873-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-3873-01

Size / count 50 μL

Specifications

Catalog number: KB-3873-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Golgi reassembly-stacking protein 1, Golgi peripheral membrane protein p65, Golgi phosphoprotein 5, GOLPH5, Golgi reassembly-stacking protein of 65 kDa, GRASP65
Gene Name: GORASP1
Gene ID: 64689
UniProt: Q9BQQ3
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human GORASP1
Target: PP-9573
Partner Proteins: Golgi reassembly-stacking protein 1; Golgi peripheral membrane protein p65; Golgi phosphoprotein 5; GOLPH5; Golgi reassembly-stacking protein of 65 kDa; GRASP65
Clone: K8U038_5C10
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 72%, Rat - 69%, Pig - 77%, Cynomolgus monkey - 94%
Purity: ≥85%
Cores: RIPTQPPSYHKKPPGTPPPSALPLGAPPPDALPPGPTPEDSPSLETGSRQSDYMEALLQAPGSSMEDPLPGPGSPSHSAPDPDGLPHFMETPLQPPPPVQRVMDPGFLDVSGISLLDNSNASVWPSLPSSTELTTTAVSTSGPEDICSSSSSHERGGEATWSGSEFEVSFLDSPGAQAQADHLPQLTLPDSLTSAASPEDGLSAELLEAQAEEEPASTEGLDTGTEAEGL
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 72%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: GOLPH5; GRASP65
Target Alternative Name: GRASP65
Host or Source: Mouse
Protein Name: Golgi reassembly stacking protein 1
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for GRASP65 Antibody (Biotin)?

The catalog number for GRASP65 Antibody (Biotin) is KB-3873.

What sizes are available for GRASP65 Antibody (Biotin)?

GRASP65 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does GRASP65 Antibody (Biotin) come in?

GRASP65 Antibody (Biotin) is available in 3 different pack sizes.

Is GRASP65 Antibody (Biotin) in stock?

GRASP65 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

What expression system was used for this recombinant protein?

The expression system, such as E. coli, HEK293, or insect cells, is listed on the datasheet under production details, which can affect post-translational modifications relevant to your application.

Can I return this product if I ordered the wrong one?

As a consumer, you have a 14-day right of withdrawal from receipt under EU consumer protection law, submitted via our withdrawal/cancellation request form. Note this applies to unused, undamaged products, and doesn’t override the expiry/storage conditions on performance-based claims.

Is this product tested for endotoxin levels?

Endotoxin testing status is noted on the datasheet where applicable, particularly for recombinant proteins intended for cell-based or functional assays. If this isn’t listed and you need confirmation, contact support with the catalogue number.