SMAD5 Antibody (Biotin)

Catalog number KB-8168-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-8168-01

Size / count 50 μL

Specifications

Catalog number: KB-8168-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Mothers against decapentaplegic homolog 5, MAD homolog 5, Mothers against DPP homolog 5, JV5-1, SMAD family member 5, SMAD 5, Smad5, hSmad5
Gene Name: SMAD5
Gene ID: 4090
UniProt: Q99717
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human SMAD5
Target: PP-1555
Partner Proteins: Mothers against decapentaplegic homolog 5; MAD homolog 5; Mothers against DPP homolog 5; JV5-1; SMAD family member 5; SMAD 5; Smad5; hSmad5
Clone: K94035_12A1
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 96%, Rat - 99%, Pig - 100%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: HSLLVQFRNLSHNEPHMPQNATFPDSFHQPNNTPFPLSPNSPYPPSPASSTYPNSPASSGPGSPFQLPADTPPPAYMPPDDQMGQDNSQP
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 96%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: MADH5
Target Alternative Name: SMAD5
Panel Description: Transcription Factors
Host or Source: Mouse
Protein Name: SMAD family member 5
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for SMAD5 Antibody (Biotin)?

The catalog number for SMAD5 Antibody (Biotin) is KB-8168.

What sizes are available for SMAD5 Antibody (Biotin)?

SMAD5 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does SMAD5 Antibody (Biotin) come in?

SMAD5 Antibody (Biotin) is available in 3 different pack sizes.

Is SMAD5 Antibody (Biotin) in stock?

SMAD5 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

What is the difference between this product and a similar catalogue number?

Differences typically involve clone, conjugate, host species, or validated applications. Compare the respective datasheets, or contact us with both catalogue numbers for a direct comparison.

Do you offer custom or private-label production of this type of product?

Yes, custom antibody development and private-label production services are available. Contact our sales team to discuss your target, timeline, and quantity requirements.

What is the immunogen used to generate this antibody?

Immunogen or antigen details used to raise this antibody are listed on the product datasheet under immunogen information.