HBEGF Antibody (Biotin)

Catalog number KB-3709-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-3709-01

Size / count 50 μL

Specifications

Catalog number: KB-3709-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Proheparin-binding EGF-like growth factor [Cleaved into: Heparin-binding EGF-like growth factor, HB-EGF, HBEGF, Diphtheria toxin receptor, DT-R]
Gene Name: HBEGF
Gene ID: 1839
UniProt: Q99075
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human HBEGF
Target: PP-3105
Partner Proteins: Proheparin-binding EGF-like growth factor [Cleaved into: Heparin-binding EGF-like growth factor; HB-EGF; HBEGF; Diphtheria toxin receptor; DT-R]
Clone: K16295_6G6
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 73%, Rat - 76%, Pig - 93%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: LLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHG
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 73%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:250~1:500
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: DTR; DTS; HEGFL
Target Alternative Name: HBEGF
Host or Source: Mouse
Protein Name: Heparin binding EGF like growth factor
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for HBEGF Antibody (Biotin)?

The catalog number for HBEGF Antibody (Biotin) is KB-3709.

What sizes are available for HBEGF Antibody (Biotin)?

HBEGF Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does HBEGF Antibody (Biotin) come in?

HBEGF Antibody (Biotin) is available in 3 different pack sizes.

Is HBEGF Antibody (Biotin) in stock?

HBEGF Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product tested for endotoxin levels?

Endotoxin testing status is noted on the datasheet where applicable, particularly for recombinant proteins intended for cell-based or functional assays. If this isn’t listed and you need confirmation, contact support with the catalogue number.

Can I request additional validation data, such as western blot images, for this product?

Additional data may be available on request. Contact our technical support team with the catalogue number and we’ll check what supporting documentation the supplier can provide.

What documentation should I request if this product is used for a regulated or intellectual-property-sensitive application?

If the product is subject to intellectual property protections, we’ll advise on any MTA or usage restrictions before shipping. Let us know your intended end use so we can confirm what’s required upfront.

All Products