LYSMD1 Antibody (Biotin)

Catalog number KB-3700-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-3700-01

Size / count 50 μL

Specifications

Catalog number: KB-3700-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: LysM and putative peptidoglycan-binding domain-containing protein 1
Gene Name: LYSMD1
Gene ID: 388695
UniProt: Q96S90
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human LYSMD1
Target: PP-9791
Partner Proteins: LysM and putative peptidoglycan-binding domain-containing protein 1
Clone: K1H006_11H12
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 82%, Rat - 80%, Pig - 92%, Cynomolgus monkey - 98%
Purity: ≥85%
Cores: ACSPVRERRLEHQLEPGDTLAGLALKYGVTMEQIKRANRLYTNDSIFLKKTLYIPILTEPRDLFNGLDSEEEKDGEEKVHPSNSEVWPHSTERKKQETGAGRANGEVLPTPGQETPTPIHDLSASDFLKKLDSQISLSKKAAAQKLKKGE
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 82%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:250~1:500
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: LYSMD1
Host or Source: Mouse
Protein Name: LysM domain containing 1
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for LYSMD1 Antibody (Biotin)?

The catalog number for LYSMD1 Antibody (Biotin) is KB-3700.

What sizes are available for LYSMD1 Antibody (Biotin)?

LYSMD1 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does LYSMD1 Antibody (Biotin) come in?

LYSMD1 Antibody (Biotin) is available in 3 different pack sizes.

Is LYSMD1 Antibody (Biotin) in stock?

LYSMD1 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

Can I get a trial-size or discounted first order of this product?

We don’t generally offer free samples, but trial discounts in exchange for feedback and validation results are almost always possible. Contact us with your intended application to arrange one.

Do you offer bulk or custom quantities of this product?

Yes. Ordering two or more units, or combining this with other products, usually qualifies for a discount depending on quantity. Contact our sales team with your required volume for a custom quote.

Do you provide a Certificate of Analysis (CoA) for this product?

A Certificate of Analysis is available for most products upon request. Contact our support team with the lot number to obtain the relevant CoA.