Caspase-10 Antibody (Biotin)

Catalog number KB-7927-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-7927-01

Size / count 50 μL

Specifications

Catalog number: KB-7927-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Caspase-10, CASP-10, Apoptotic protease Mch-4, FAS-associated death domain protein interleukin-1B-converting enzyme 2, FLICE2, ICE-like apoptotic protease 4) [Cleaved into: Caspase-10 subunit p23/17, Caspase-10 subunit p12]
Gene Name: CASP10
Gene ID: 843
UniProt: Q92851
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CASP10
Target: PP-1355
Partner Proteins: Caspase-10; CASP-10; Apoptotic protease Mch-4; FAS-associated death domain protein interleukin-1B-converting enzyme 2; FLICE2; ICE-like apoptotic protease 4) [Cleaved into: Caspase-10 subunit p23/17; Caspase-10 subunit p12]
Clone: K56014_8D10
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 43%, Pig - 58%, Cynomolgus monkey - 86%
Purity: ≥85%
Cores: KTFLEALPQESWQNKHAGSNGNRATNGAPSLVSRGMQGASANTLNSETSTKRAAVYRMNRNHRGLCVIVNNHSFTSLKDRQGTHKDAEIL
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 43%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: MCH4
Target Alternative Name: Caspase-10
Panel Description: Neurodegenerative Diseases Marker
Host or Source: Mouse
Protein Name: Caspase 10
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Caspase-10 Antibody (Biotin)?

The catalog number for Caspase-10 Antibody (Biotin) is KB-7927.

What sizes are available for Caspase-10 Antibody (Biotin)?

Caspase-10 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Caspase-10 Antibody (Biotin) come in?

Caspase-10 Antibody (Biotin) is available in 3 different pack sizes.

Is Caspase-10 Antibody (Biotin) in stock?

Caspase-10 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

What is the immunogen used to generate this antibody?

Immunogen or antigen details used to raise this antibody are listed on the product datasheet under immunogen information.

What is the recommended positive control for this assay?

A recommended positive control, where one is specified by the manufacturer, is listed on the datasheet or in the assay protocol.

How should this product be stored?

Storage conditions depend on the specific reagent and are listed on the product datasheet, with most antibodies and proteins requiring -20°C unless stated otherwise. It is your responsibility to store the product correctly immediately upon receipt; damage from improper storage after delivery is not eligible for replacement.