ARAP3 Antibody (Biotin)

Catalog number KB-28700-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-28700-01

Size / count 50 μL

Specifications

Catalog number: KB-28700-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 3, Centaurin-delta-3, Cnt-d3
Gene Name: ARAP3
Gene ID: 64411
UniProt: Q8WWN8
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human ARAP3
Target: PP-8513
Partner Proteins: Arf-GAP with Rho-GAP domain; ANK repeat and PH domain-containing protein 3; Centaurin-delta-3; Cnt-d3
Clone: KBL004_11G11
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 74%, Pig - 79%, Cynomolgus monkey - 93%
Purity: ≥85%
Cores: LDPKSDSAMEPSPSPAPQAQPPKPVPKPRTVFGGLSGPATTQRPGLSPALGGPGVSRSPEPSPRPPPLPTSSSEQSSALNTVEMMPNSIYFGLDSRGRAQAAQDKAPDSSQISAPTPALRPTTGTVHIMDPGCLYYGVQPVGTPGAPDRRESRGVCQGRAEHRLSRQDLE
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 74%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: CENTD3
Target Alternative Name: ARAP3
Host or Source: Mouse
Protein Name: ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 3, ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 3
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for ARAP3 Antibody (Biotin)?

The catalog number for ARAP3 Antibody (Biotin) is KB-28700.

What sizes are available for ARAP3 Antibody (Biotin)?

ARAP3 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does ARAP3 Antibody (Biotin) come in?

ARAP3 Antibody (Biotin) is available in 3 different pack sizes.

Is ARAP3 Antibody (Biotin) in stock?

ARAP3 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

What host species was used to raise this antibody?

The host species used in production is listed under product specifications on the datasheet, and is relevant when selecting a compatible secondary antibody for your assay.

What is the difference between this product and a similar catalogue number?

Differences typically involve clone, conjugate, host species, or validated applications. Compare the respective datasheets, or contact us with both catalogue numbers for a direct comparison.

Do you offer custom or private-label production of this type of product?

Yes, custom antibody development and private-label production services are available. Contact our sales team to discuss your target, timeline, and quantity requirements.