CD300LF Antibody (Biotin)

Catalog number KB-27140-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-27140-01

Size / count 50 μL

Specifications

Catalog number: KB-27140-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: CMRF35-like molecule 1, CLM-1, CD300 antigen-like family member F, Immune receptor expressed on myeloid cells 1, IREM-1, Immunoglobulin superfamily member 13, IgSF13, NK inhibitory receptor, CD antigen CD300f
Gene Name: CD300LF
Gene ID: 146722
UniProt: Q8TDQ1
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CD300LF
Target Antigen: CD300f
Target: PP-1767
Partner Proteins: CMRF35-like molecule 1; CLM-1; CD300 antigen-like family member F; Immune receptor expressed on myeloid cells 1; IREM-1; Immunoglobulin superfamily member 13; IgSF13; NK inhibitory receptor; CD antigen CD300f
Clone: K1H016_10D11
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 53%, Rat - 55%, Pig - 58%, Cynomolgus monkey - 85%
Purity: ≥85%
Cores: SPEQVLQPLEGDLCYADLTLQLAGTSPQKATTKLSSAQVDQVEVEYVTMASLPKEDISYASLTLGAEDQEPTYCNMGHLSSHLPGRGPEE
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 53%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: CD300F; CLM1; IGSF13; IREM1; NKIR
Target Alternative Name: CD300LF
Panel Description: CD Antigen
Host or Source: Mouse
Protein Name: CD300 molecule like family member f
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for CD300LF Antibody (Biotin)?

The catalog number for CD300LF Antibody (Biotin) is KB-27140.

What sizes are available for CD300LF Antibody (Biotin)?

CD300LF Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does CD300LF Antibody (Biotin) come in?

CD300LF Antibody (Biotin) is available in 3 different pack sizes.

Is CD300LF Antibody (Biotin) in stock?

CD300LF Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

Can I request additional validation data, such as western blot images, for this product?

Additional data may be available on request. Contact our technical support team with the catalogue number and we’ll check what supporting documentation the supplier can provide.

What documentation should I request if this product is used for a regulated or intellectual-property-sensitive application?

If the product is subject to intellectual property protections, we’ll advise on any MTA or usage restrictions before shipping. Let us know your intended end use so we can confirm what’s required upfront.

Is this antibody conjugated?

Conjugation status, such as unconjugated, HRP, FITC, or biotin, is specified in the product name and confirmed on the datasheet.