CD300LF Antibody (Biotin)

Catalog number KB-26608-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-26608-01

Size / count 50 μL

Specifications

Catalog number: KB-26608-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: CMRF35-like molecule 1, CLM-1, CD300 antigen-like family member F, Immune receptor expressed on myeloid cells 1, IREM-1, Immunoglobulin superfamily member 13, IgSF13, NK inhibitory receptor, CD antigen CD300f
Gene Name: CD300LF
Gene ID: 146722
UniProt: Q8TDQ1
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CD300LF
Target Antigen: CD300f
Target: PP-1767
Partner Proteins: CMRF35-like molecule 1; CLM-1; CD300 antigen-like family member F; Immune receptor expressed on myeloid cells 1; IREM-1; Immunoglobulin superfamily member 13; IgSF13; NK inhibitory receptor; CD antigen CD300f
Clone: K1H016_15D3
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 53%, Rat - 55%, Pig - 58%, Cynomolgus monkey - 85%
Purity: ≥85%
Cores: SPEQVLQPLEGDLCYADLTLQLAGTSPQKATTKLSSAQVDQVEVEYVTMASLPKEDISYASLTLGAEDQEPTYCNMGHLSSHLPGRGPEE
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 53%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: CD300F; CLM1; IGSF13; IREM1; NKIR
Target Alternative Name: CD300LF
Panel Description: CD Antigen
Host or Source: Mouse
Protein Name: CD300 molecule like family member f
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for CD300LF Antibody (Biotin)?

The catalog number for CD300LF Antibody (Biotin) is KB-26608.

What sizes are available for CD300LF Antibody (Biotin)?

CD300LF Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does CD300LF Antibody (Biotin) come in?

CD300LF Antibody (Biotin) is available in 3 different pack sizes.

Is CD300LF Antibody (Biotin) in stock?

CD300LF Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

Is antigen retrieval required for IHC with this antibody?

Recommended antigen retrieval methods, where applicable, are listed on the datasheet under the IHC protocol section.

What temperature does this product ship at?

Shipping temperature is chosen based on the product’s stability needs, ranging from ambient to dry ice, and is indicated on the product page. Any related shipping fee is shown clearly in your quotation.

What is the molecular weight of the target protein?

Molecular weight information, where applicable, is listed on the datasheet under target details, useful for confirming the correct band on western blot.

All Products