DTX3L Antibody (Biotin)

Catalog number KB-8106-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-8106-01

Size / count 50 μL

Specifications

Catalog number: KB-8106-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: E3 ubiquitin-protein ligase DTX3L, B-lymphoma- and BAL-associated protein, Protein deltex-3-like, RING-type E3 ubiquitin transferase DTX3L, Rhysin-2, Rhysin2
Gene Name: DTX3L
Gene ID: 151636
UniProt: Q8TDB6
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human DTX3L
Target: PP-8044
Partner Proteins: E3 ubiquitin-protein ligase DTX3L; B-lymphoma- and BAL-associated protein; Protein deltex-3-like; RING-type E3 ubiquitin transferase DTX3L; Rhysin-2; Rhysin2
Clone: K24022_9H8
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 51%, Pig - 57%, Cynomolgus monkey - 88%
Purity: ≥85%
Cores: RVRRKLESYFQSSKSSGGGECTVSTQEHEAPGTFRVEFSERAAKERVLKKGEHQILVDEKPVPIFLVPTENSIKKNTRPQISSLTQSQAETPSGDMHQHE
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 51%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: BBAP
Target Alternative Name: DTX3L
Panel Description: E3 Ligase, DNA binding & Chromatin, Ubiquitin-Proteasome System
Host or Source: Mouse
Protein Name: Deltex E3 ubiquitin ligase 3L
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for DTX3L Antibody (Biotin)?

The catalog number for DTX3L Antibody (Biotin) is KB-8106.

What sizes are available for DTX3L Antibody (Biotin)?

DTX3L Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does DTX3L Antibody (Biotin) come in?

DTX3L Antibody (Biotin) is available in 3 different pack sizes.

Is DTX3L Antibody (Biotin) in stock?

DTX3L Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

What is the recommended dilution for this antibody?

A recommended dilution range for each validated application is provided on the datasheet, but optimal dilution should be titrated for your specific experimental system, sample type, and detection method.

What is the recommended storage temperature after reconstitution?

Post-reconstitution storage guidance is listed on the datasheet, typically requiring aliquoting and storage at -20°C or -80°C to preserve activity.

Can this product be used in multiplex assays?

Multiplex compatibility depends on the specific product and detection panel. Contact our technical support team with details of your multiplex system for guidance before ordering.