DNER Antibody (Biotin)

Catalog number KB-3905-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-3905-01

Size / count 50 μL

Specifications

Catalog number: KB-3905-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Delta and Notch-like epidermal growth factor-related receptor
Gene Name: DNER
Gene ID: 92737
UniProt: Q8NFT8
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human DNER
Target: PP-332
Partner Proteins: Delta and Notch-like epidermal growth factor-related receptor
Clone: K29080_6C11
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 91%, Rat - 33%, Pig - 92%, Cynomolgus monkey - 98%
Purity: ≥85%
Cores: RQLQPVPATQEPDKILPRSQATVTLPTWQPKTGQKVVEMKWDQVEVIPDIACGNASSNSSAGGRLVSFEVPQNTSVKIRQDATASLILLWKVTATGFQQCSLIDGRSVTPLQASGGLVLLEEMLALGNNHFIGFVNDSVTKSIVALRLTLVVKVSTCVPGESHANDLECSGKGKCTTKPSEATFSCTCEEQYVGTFCEEYDACQRKPCQNNASCIDANEKQDGSNFTCVCLPGYTGELCQ
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 91%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: BET
Target Alternative Name: DNER
Host or Source: Mouse
Protein Name: Delta/notch like EGF repeat containing
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for DNER Antibody (Biotin)?

The catalog number for DNER Antibody (Biotin) is KB-3905.

What sizes are available for DNER Antibody (Biotin)?

DNER Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does DNER Antibody (Biotin) come in?

DNER Antibody (Biotin) is available in 3 different pack sizes.

Is DNER Antibody (Biotin) in stock?

DNER Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product species cross-reactive?

Cross-reactivity data, based on available testing, is listed under the reactivity section of the datasheet. Contact us if you need reactivity confirmed for a species not listed.

Is there an additional fee for hazardous or dry ice shipping of this product?

Yes, if this product requires dry ice or is classed as hazardous for transport, the additional fee will be explicitly shown in your quotation before you confirm the order, so there are no surprise charges later.

How many freeze-thaw cycles can this product tolerate?

We recommend aliquoting the product upon receipt to avoid repeated freeze-thaw cycles, which can reduce activity and stability. This is your responsibility once the product has been delivered.

All Products