BANK1 Antibody (Biotin)

Catalog number KB-1041-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-1041-01

Size / count 50 μL

Specifications

Catalog number: KB-1041-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: B-cell scaffold protein with ankyrin repeats
Gene Name: BANK1
Gene ID: 55024
UniProt: Q8NDB2
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human BANK1
Target: PP-911
Partner Proteins: B-cell scaffold protein with ankyrin repeats
Clone: K92023_4B5
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 69%, Pig - 79%, Cynomolgus monkey - 94%
Purity: ≥85%
Cores: PGTMVEGQMERSQNWGHPGVRQETGDEPKGEKEKKEEEKEQEEEEDPYTFAEIDDSEYDMILANLSIKKKTGSRSFIINRPPAPTPRPTSIPPKEETTPYIAQVFQQKTARRQSDDDKFCGLPKKQDRARIESPAFSTLRGCLTDGQEELILLQEKVKNG
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 69%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: BANK1
Host or Source: Mouse
Protein Name: B cell scaffold protein with ankyrin repeats 1
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for BANK1 Antibody (Biotin)?

The catalog number for BANK1 Antibody (Biotin) is KB-1041.

What sizes are available for BANK1 Antibody (Biotin)?

BANK1 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does BANK1 Antibody (Biotin) come in?

BANK1 Antibody (Biotin) is available in 3 different pack sizes.

Is BANK1 Antibody (Biotin) in stock?

BANK1 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

What applications has this product been validated for?

Validated applications such as WB, ELISA, IHC, ICC, or FC are listed on the product datasheet. If you need application-specific validation data before ordering, contact our technical support team with the catalogue number.

How do I reconstitute this lyophilized product?

Reconstitution instructions, including the recommended diluent and final concentration, are provided on the datasheet. Aliquot immediately after reconstitution to avoid repeated freeze-thaw cycles.

What is the recommended incubation time for this antibody?

A suggested incubation time is provided in the recommended protocol on the datasheet, but may need adjusting depending on your sample type and detection system.