LRRC75A Antibody (Biotin)

Catalog number KB-3718-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-3718-01

Size / count 50 μL

Specifications

Catalog number: KB-3718-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Leucine-rich repeat-containing protein 75A, Leucine-rich repeat-containing protein FAM211A
Gene Name: LRRC75A
Gene ID: 388341
UniProt: Q8NAA5
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human LRRC75A
Target: PP-9664
Partner Proteins: Leucine-rich repeat-containing protein 75A; Leucine-rich repeat-containing protein FAM211A
Clone: K16306_15G10
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 88%, Pig - 89%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: PQACLKAVLAGSPPDNTVDLSGIPLTSRDLERVTSYLQRCGEQVDSVELGFTGLTDDMVLQLLPALSTLPRLTTLALNGNRLTRAVLRDLTDILKDPSKFPNVTWIDLGNNVDIFSLPQPFLLSLRKRSPKQGHLPTILELGEGPGSGEEVREGTVGQEDPGGGPVAPAEDHHEGKETVA
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 88%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:250~1:500
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: C17orf76; FAM211A
Target Alternative Name: LRRC75A
Host or Source: Mouse
Protein Name: Leucine rich repeat containing 75A
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for LRRC75A Antibody (Biotin)?

The catalog number for LRRC75A Antibody (Biotin) is KB-3718.

What sizes are available for LRRC75A Antibody (Biotin)?

LRRC75A Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does LRRC75A Antibody (Biotin) come in?

LRRC75A Antibody (Biotin) is available in 3 different pack sizes.

Is LRRC75A Antibody (Biotin) in stock?

LRRC75A Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

How long will it take to receive this product if it’s custom made?

Lead times depend on the product type: custom polyclonal antibodies typically take 12-14 weeks, monoclonal antibodies 15-17 weeks, made-to-order recombinant proteins 4-8 weeks, and made-to-order recombinant antibodies 6-8 weeks. These are estimates and may shift due to production delays.

What is the recommended dilution for this antibody?

A recommended dilution range for each validated application is provided on the datasheet, but optimal dilution should be titrated for your specific experimental system, sample type, and detection method.

What is the recommended storage temperature after reconstitution?

Post-reconstitution storage guidance is listed on the datasheet, typically requiring aliquoting and storage at -20°C or -80°C to preserve activity.

All Products