CADM3 Antibody (Biotin)

Catalog number KB-26898-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-26898-01

Size / count 50 μL

Specifications

Catalog number: KB-26898-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Cell adhesion molecule 3, Brain immunoglobulin receptor, Immunoglobulin superfamily member 4B, IgSF4B, Nectin-like protein 1, NECL-1, Synaptic cell adhesion molecule 3, SynCAM3, TSLC1-like protein 1, TSLL1
Gene Name: CADM3
Gene ID: 57863
UniProt: Q8N126
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CADM3
Target: P04264PAD
Partner Proteins: Cell adhesion molecule 3; Brain immunoglobulin receptor; Immunoglobulin superfamily member 4B; IgSF4B; Nectin-like protein 1; NECL-1; Synaptic cell adhesion molecule 3; SynCAM3; TSLC1-like protein 1; TSLL1
Clone: K24055_20D3
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 94%, Rat - 91%, Pig - 95%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: QKPIITGYKSSLREKDTATLNCQSSGSKPAARLTWRKGDQELHGEPTRIQEDPNGKTFTVSSSVTFQVTREDDGASIVCSVNHESLKGAD
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 94%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: IGSF4B; NECL1; SYNCAM3; TSLL1
Target Alternative Name: CADM3
Host or Source: Mouse
Protein Name: Cell adhesion molecule 3
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for CADM3 Antibody (Biotin)?

The catalog number for CADM3 Antibody (Biotin) is KB-26898.

What sizes are available for CADM3 Antibody (Biotin)?

CADM3 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does CADM3 Antibody (Biotin) come in?

CADM3 Antibody (Biotin) is available in 3 different pack sizes.

Is CADM3 Antibody (Biotin) in stock?

CADM3 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

What temperature does this product ship at?

Shipping temperature is chosen based on the product’s stability needs, ranging from ambient to dry ice, and is indicated on the product page. Any related shipping fee is shown clearly in your quotation.

What is the molecular weight of the target protein?

Molecular weight information, where applicable, is listed on the datasheet under target details, useful for confirming the correct band on western blot.

How long will it take to receive this product if it’s custom made?

Lead times depend on the product type: custom polyclonal antibodies typically take 12-14 weeks, monoclonal antibodies 15-17 weeks, made-to-order recombinant proteins 4-8 weeks, and made-to-order recombinant antibodies 6-8 weeks. These are estimates and may shift due to production delays.