KIRREL3 Antibody (Biotin)

Catalog number KB-7393-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-7393-01

Size / count 50 μL

Specifications

Catalog number: KB-7393-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Kin of IRRE-like protein 3, Kin of irregular chiasm-like protein 3, Nephrin-like protein 2) [Cleaved into: Processed kin of IRRE-like protein 3]
Gene Name: KIRREL3
Gene ID: 84623
UniProt: Q8IZU9
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human KIRREL3
Target: PP-905
Partner Proteins: Kin of IRRE-like protein 3; Kin of irregular chiasm-like protein 3; Nephrin-like protein 2) [Cleaved into: Processed kin of IRRE-like protein 3]
Clone: K40075_14B8
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 96%, Rat - 30%, Pig - 98%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: VSAKNDIRVEIVHKEPASGREGEEHSTIKQLMMDRGEFQQDSVLKQLEVLKEEEKEFQNLKDPTNGYYSVNTFKEHHSTPTISLSSCQPDLRPAGKQRVPTGMSFTNIYS
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 96%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: KIAA1867; NEPH2
Target Alternative Name: KIRREL3
Host or Source: Mouse
Protein Name: Kirre like nephrin family adhesion molecule 3
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for KIRREL3 Antibody (Biotin)?

The catalog number for KIRREL3 Antibody (Biotin) is KB-7393.

What sizes are available for KIRREL3 Antibody (Biotin)?

KIRREL3 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does KIRREL3 Antibody (Biotin) come in?

KIRREL3 Antibody (Biotin) is available in 3 different pack sizes.

Is KIRREL3 Antibody (Biotin) in stock?

KIRREL3 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product species cross-reactive?

Cross-reactivity data, based on available testing, is listed under the reactivity section of the datasheet. Contact us if you need reactivity confirmed for a species not listed.

Is there an additional fee for hazardous or dry ice shipping of this product?

Yes, if this product requires dry ice or is classed as hazardous for transport, the additional fee will be explicitly shown in your quotation before you confirm the order, so there are no surprise charges later.

How many freeze-thaw cycles can this product tolerate?

We recommend aliquoting the product upon receipt to avoid repeated freeze-thaw cycles, which can reduce activity and stability. This is your responsibility once the product has been delivered.

All Products