FOXP4 Antibody (Biotin)

Catalog number KB-23238-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-23238-01

Size / count 50 μL

Specifications

Catalog number: KB-23238-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Forkhead box protein P4, Fork head-related protein-like A
Gene Name: FOXP4
Gene ID: 116113
UniProt: Q8IVH2
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human FOXP4
Target: PP-3104
Partner Proteins: Forkhead box protein P4; Fork head-related protein-like A
Clone: K9N025_5B7
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 81%, Pig - 89%, Cynomolgus monkey - 97%
Purity: ≥85%
Cores: RSAPSGQNGVGSLSGQADGSSGGATGTTASGTGREVTTGADSNGEMSPAELLHFQQQQALQVARQFLLQQASGLSSPGNNDSKQSASAVQ
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 81%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: FKHLA
Target Alternative Name: FOXP4
Panel Description: DNA binding & Chromatin, Transcription Factors
Host or Source: Mouse
Protein Name: Forkhead box P4
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for FOXP4 Antibody (Biotin)?

The catalog number for FOXP4 Antibody (Biotin) is KB-23238.

What sizes are available for FOXP4 Antibody (Biotin)?

FOXP4 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does FOXP4 Antibody (Biotin) come in?

FOXP4 Antibody (Biotin) is available in 3 different pack sizes.

Is FOXP4 Antibody (Biotin) in stock?

FOXP4 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

Is this antibody conjugated?

Conjugation status, such as unconjugated, HRP, FITC, or biotin, is specified in the product name and confirmed on the datasheet.

What is the sensitivity of this ELISA kit?

Assay sensitivity, including the minimum detectable dose, is listed on the datasheet. Kits that are assembled on order typically ship within 2-4 weeks.

Do you ship this product with dry ice?

Some products, including certain cell lines and biologics, require dry ice for transportation, which carries an additional fee shown clearly in your quotation. Dry ice delivery isn’t always possible to every destination due to transit time or local restrictions, so we check feasibility in advance and you must store the goods at the correct temperature the moment they arrive.