Recombinant CDC20B Antibody

Catalog number RN-12084-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-12084-01

Size / count 50 μL

Specifications

Catalog number: RN-12084-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Cell division cycle protein 20 homolog B
Gene Name: CDC20B
Gene ID: 166979
UniProt: Q86Y33
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CDC20B
Target: PP-6672
Partner Proteins: Cell division cycle protein 20 homolog B
Clone: K29082_6F11
Conjugation: Unconjugated
Applications: Top_IP/ChIP
Validation: Top_IP/ChIP
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 58%, Pig - 73%, Cynomolgus monkey - 88%
Purity: ≥85%
Cores: DLKQKRSQDSANVLDSVNATYSDFKSNFAKRLSAEVPVASSPITTRWQQSQTRALSSDSFGEEQSTTYLPEASGSVLKTPPEKETLTLGSRKEQLKTPSKGISETSNSALHFCKAPHAMDRDWKESVASKGQKCLKQLFVTQNVVQQANG
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 58%
Recombinant Antibody: Yes
IP Dilution: 1:100
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: CDC20B
Host or Source: Mouse
Protein Name: Cell division cycle 20B
IP description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant CDC20B Antibody?

The catalog number for Recombinant CDC20B Antibody is RN-12084.

What sizes are available for Recombinant CDC20B Antibody?

Recombinant CDC20B Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant CDC20B Antibody come in?

Recombinant CDC20B Antibody is available in 3 different pack sizes.

Is Recombinant CDC20B Antibody in stock?

Recombinant CDC20B Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Do you ship this product with dry ice?

Some products, including certain cell lines and biologics, require dry ice for transportation, which carries an additional fee shown clearly in your quotation. Dry ice delivery isn’t always possible to every destination due to transit time or local restrictions, so we check feasibility in advance and you must store the goods at the correct temperature the moment they arrive.

Is this product species cross-reactive?

Cross-reactivity data, based on available testing, is listed under the reactivity section of the datasheet. Contact us if you need reactivity confirmed for a species not listed.

Is there an additional fee for hazardous or dry ice shipping of this product?

Yes, if this product requires dry ice or is classed as hazardous for transport, the additional fee will be explicitly shown in your quotation before you confirm the order, so there are no surprise charges later.

All Products