GCET1 Antibody (Biotin)

Catalog number KB-29018-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-29018-01

Size / count 50 μL

Specifications

Catalog number: KB-29018-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Serpin A9, Centerin, Germinal center B-cell-expressed transcript 1 protein
Gene Name: SERPINA9
Gene ID: 327657
UniProt: Q86WD7
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human SERPINA9
Target: PP-3317
Partner Proteins: Serpin A9; Centerin; Germinal center B-cell-expressed transcript 1 protein
Clone: K9N030_4B4
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 65%, Rat - 43%, Pig - 50%, Cynomolgus monkey - 92%
Purity: ≥85%
Cores: FDKNADFSGIAKRDSLQVSKATHKAVLDVSEEGTEATAATTTKFIVRSKDGPSYFTVSFNRTFLMMITNKATDGILFLGK
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 65%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: GCET1; SERPINA11
Target Alternative Name: GCET1
Host or Source: Mouse
Protein Name: Serpin family A member 9
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for GCET1 Antibody (Biotin)?

The catalog number for GCET1 Antibody (Biotin) is KB-29018.

What sizes are available for GCET1 Antibody (Biotin)?

GCET1 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does GCET1 Antibody (Biotin) come in?

GCET1 Antibody (Biotin) is available in 3 different pack sizes.

Is GCET1 Antibody (Biotin) in stock?

GCET1 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

What dilution range is recommended for immunohistochemistry (IHC) with this antibody?

A starting IHC dilution range is listed on the datasheet, but should be optimized for your specific tissue type and staining protocol.

Can I request a Safety Data Sheet (SDS) for this product?

Yes, safety data sheets are available for hazardous or chemically classified products and can be provided on request or downloaded from the product page.

Can this product be used for co-immunoprecipitation (Co-IP)?

Suitability for Co-IP depends on the specific antibody and is noted under validated applications on the datasheet. If it isn’t listed, contact our technical support team for guidance based on your target and sample type.

All Products