GCET1 Antibody (Biotin)

Catalog number KB-29029-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-29029-01

Size / count 50 μL

Specifications

Catalog number: KB-29029-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Serpin A9, Centerin, Germinal center B-cell-expressed transcript 1 protein
Gene Name: SERPINA9
Gene ID: 327657
UniProt: Q86WD7
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human SERPINA9
Target: PP-3317
Partner Proteins: Serpin A9; Centerin; Germinal center B-cell-expressed transcript 1 protein
Clone: K9N030_14D5
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 65%, Rat - 43%, Pig - 50%, Cynomolgus monkey - 92%
Purity: ≥85%
Cores: FDKNADFSGIAKRDSLQVSKATHKAVLDVSEEGTEATAATTTKFIVRSKDGPSYFTVSFNRTFLMMITNKATDGILFLGK
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 65%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: GCET1; SERPINA11
Target Alternative Name: GCET1
Host or Source: Mouse
Protein Name: Serpin family A member 9
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for GCET1 Antibody (Biotin)?

The catalog number for GCET1 Antibody (Biotin) is KB-29029.

What sizes are available for GCET1 Antibody (Biotin)?

GCET1 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does GCET1 Antibody (Biotin) come in?

GCET1 Antibody (Biotin) is available in 3 different pack sizes.

Is GCET1 Antibody (Biotin) in stock?

GCET1 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product classed as hazardous or restricted for shipping?

Some products are subject to special import/export regulations, dangerous goods handling, or licensing requirements. Where this applies, it’s noted on the product page, and any required extra documents or fees will be confirmed with you before dispatch, never added without your consent.

Can you help me confirm if this product is right for my specific experiment?

Yes, contact us with details of your sample type, species, and intended application, and our specialists will confirm suitability or suggest an alternative from our supplier network if this isn’t the best fit.

What is the purity of this recombinant protein?

Purity, typically assessed by SDS-PAGE, is listed on the datasheet under quality control data.

All Products