ZC3HC1 Antibody (Biotin)

Catalog number KB-3708-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-3708-01

Size / count 50 μL

Specifications

Catalog number: KB-3708-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Zinc finger C3HC-type protein 1, Nuclear-interacting partner of ALK, hNIPA, Nuclear-interacting partner of anaplastic lymphoma kinase
Gene Name: ZC3HC1
Gene ID: 51530
UniProt: Q86WB0
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human ZC3HC1
Target: PP-10150
Partner Proteins: Zinc finger C3HC-type protein 1; Nuclear-interacting partner of ALK; hNIPA; Nuclear-interacting partner of anaplastic lymphoma kinase
Clone: K1H005_20E9
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 87%, Pig - 90%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: AEKSPGPIVSRTRSWDSSSPVDRPEPEAASPTTRTRPVTRSMGTGDTPGLEVPSSPLRKAKRARLCSSSSSDTSSRSFFDPTSQHRDWCPWVNITLGKESRENGGTEPDASAPAEPGWKAVLTILLAHKQSSQPAETDSM
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 87%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:250~1:500
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: NIPA
Target Alternative Name: ZC3HC1
Panel Description: E3 Ligase, Ubiquitin-Proteasome System
Host or Source: Mouse
Protein Name: Zinc finger C3HC-type containing 1
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2b

Frequently Asked Questions

What is the catalog number for ZC3HC1 Antibody (Biotin)?

The catalog number for ZC3HC1 Antibody (Biotin) is KB-3708.

What sizes are available for ZC3HC1 Antibody (Biotin)?

ZC3HC1 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does ZC3HC1 Antibody (Biotin) come in?

ZC3HC1 Antibody (Biotin) is available in 3 different pack sizes.

Is ZC3HC1 Antibody (Biotin) in stock?

ZC3HC1 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product tested for endotoxin levels?

Endotoxin testing status is noted on the datasheet where applicable, particularly for recombinant proteins intended for cell-based or functional assays. If this isn’t listed and you need confirmation, contact support with the catalogue number.

Can I request additional validation data, such as western blot images, for this product?

Additional data may be available on request. Contact our technical support team with the catalogue number and we’ll check what supporting documentation the supplier can provide.

What documentation should I request if this product is used for a regulated or intellectual-property-sensitive application?

If the product is subject to intellectual property protections, we’ll advise on any MTA or usage restrictions before shipping. Let us know your intended end use so we can confirm what’s required upfront.