Recombinant ZC3HC1 Antibody

Catalog number RN-12378-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-12378-01

Size / count 50 μL

Specifications

Catalog number: RN-12378-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Zinc finger C3HC-type protein 1, Nuclear-interacting partner of ALK, hNIPA, Nuclear-interacting partner of anaplastic lymphoma kinase
Gene Name: ZC3HC1
Gene ID: 51530
UniProt: Q86WB0
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human ZC3HC1
Target: PP-10150
Partner Proteins: Zinc finger C3HC-type protein 1; Nuclear-interacting partner of ALK; hNIPA; Nuclear-interacting partner of anaplastic lymphoma kinase
Clone: K1H005_2H7
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 87%, Pig - 90%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: AEKSPGPIVSRTRSWDSSSPVDRPEPEAASPTTRTRPVTRSMGTGDTPGLEVPSSPLRKAKRARLCSSSSSDTSSRSFFDPTSQHRDWCPWVNITLGKESRENGGTEPDASAPAEPGWKAVLTILLAHKQSSQPAETDSM
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 87%
Recombinant Antibody: Yes
IHC Dilution: 1:100~1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: NIPA
Target Alternative Name: ZC3HC1
Panel Description: E3 Ligase, Ubiquitin-Proteasome System
Host or Source: Mouse
Protein Name: Zinc finger C3HC-type containing 1
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant ZC3HC1 Antibody?

The catalog number for Recombinant ZC3HC1 Antibody is RN-12378.

What sizes are available for Recombinant ZC3HC1 Antibody?

Recombinant ZC3HC1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant ZC3HC1 Antibody come in?

Recombinant ZC3HC1 Antibody is available in 3 different pack sizes.

Is Recombinant ZC3HC1 Antibody in stock?

Recombinant ZC3HC1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What buffer is this product supplied in?

The formulation or storage buffer is listed on the product datasheet. If you require a carrier-free or custom formulation, contact us before ordering, as this may involve a made-to-order production timeline.

What dilution range is recommended for immunohistochemistry (IHC) with this antibody?

A starting IHC dilution range is listed on the datasheet, but should be optimized for your specific tissue type and staining protocol.

Can I request a Safety Data Sheet (SDS) for this product?

Yes, safety data sheets are available for hazardous or chemically classified products and can be provided on request or downloaded from the product page.

All Products