APBB1IP Antibody (Biotin)

Catalog number KB-2533-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-2533-01

Size / count 50 μL

Specifications

Catalog number: KB-2533-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Amyloid beta A4 precursor protein-binding family B member 1-interacting protein, APBB1-interacting protein 1, Proline-rich EVH1 ligand 1, PREL-1, Proline-rich protein 73, Rap1-GTP-interacting adapter molecule, RIAM, Retinoic acid-responsive proline-rich protein 1, RARP-1
Gene Name: APBB1IP
Gene ID: 54518
UniProt: Q7Z5R6
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human APBB1IP
Target: PP-891
Partner Proteins: Amyloid beta A4 precursor protein-binding family B member 1-interacting protein; APBB1-interacting protein 1; Proline-rich EVH1 ligand 1; PREL-1; Proline-rich protein 73; Rap1-GTP-interacting adapter molecule; RIAM; Retinoic acid-responsive proline-rich protein 1; RARP-1
Clone: K49025_1A12
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 81%, Rat - 36%, Pig - 90%, Cynomolgus monkey - 96%
Purity: ≥85%
Cores: RTIQAQKESLQNQHHSASLQASIFSGAASLGYGTNVAATGISQYEDDLPPPPADPVLDLPLPPPPPEPLSQEEEEAQAKADKIKLALEKLKEAKVKKLVVKVHMNDNSTKSLMVDERQLARDVLDNLFEKTHCDCNVDWCLYEIYPELQIERFFEDHENVVEVLSDWTRDTENKILFLEK
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 81%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: PREL1; RARP1; RIAM
Target Alternative Name: APBB1IP
Host or Source: Mouse
Protein Name: Amyloid beta precursor protein binding family B member 1 interacting protein
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for APBB1IP Antibody (Biotin)?

The catalog number for APBB1IP Antibody (Biotin) is KB-2533.

What sizes are available for APBB1IP Antibody (Biotin)?

APBB1IP Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does APBB1IP Antibody (Biotin) come in?

APBB1IP Antibody (Biotin) is available in 3 different pack sizes.

Is APBB1IP Antibody (Biotin) in stock?

APBB1IP Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

What expression system was used for this recombinant protein?

The expression system, such as E. coli, HEK293, or insect cells, is listed on the datasheet under production details, which can affect post-translational modifications relevant to your application.

Can I return this product if I ordered the wrong one?

As a consumer, you have a 14-day right of withdrawal from receipt under EU consumer protection law, submitted via our withdrawal/cancellation request form. Note this applies to unused, undamaged products, and doesn’t override the expiry/storage conditions on performance-based claims.

Is this product tested for endotoxin levels?

Endotoxin testing status is noted on the datasheet where applicable, particularly for recombinant proteins intended for cell-based or functional assays. If this isn’t listed and you need confirmation, contact support with the catalogue number.