DPPA4 Antibody (Biotin)

Catalog number KB-7884-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-7884-01

Size / count 50 μL

Specifications

Catalog number: KB-7884-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Developmental pluripotency-associated protein 4
Gene Name: DPPA4
Gene ID: 55211
UniProt: Q7L190
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human DPPA4
Target: PP-2364
Partner Proteins: Developmental pluripotency-associated protein 4
Clone: K29062_10F11
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 56%, Rat - 51%, Pig - 55%, Cynomolgus monkey - 94%
Purity: ≥85%
Cores: LPGTSAKRTKEKMSIKGSKVLCPKKKAEHTDNPRPQKKIPIPPLPSKLPPVNLIHRDILRAWCQQLKLSSKGQKLDAYKRLCAFAYPNQKDFPSTAKEAKIRKSLQKKLKVEKGETSLQS
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 56%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: DPPA4
Host or Source: Mouse
Protein Name: Developmental pluripotency associated 4
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for DPPA4 Antibody (Biotin)?

The catalog number for DPPA4 Antibody (Biotin) is KB-7884.

What sizes are available for DPPA4 Antibody (Biotin)?

DPPA4 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does DPPA4 Antibody (Biotin) come in?

DPPA4 Antibody (Biotin) is available in 3 different pack sizes.

Is DPPA4 Antibody (Biotin) in stock?

DPPA4 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

Is there an additional fee for hazardous or dry ice shipping of this product?

Yes, if this product requires dry ice or is classed as hazardous for transport, the additional fee will be explicitly shown in your quotation before you confirm the order, so there are no surprise charges later.

How many freeze-thaw cycles can this product tolerate?

We recommend aliquoting the product upon receipt to avoid repeated freeze-thaw cycles, which can reduce activity and stability. This is your responsibility once the product has been delivered.

Is antigen retrieval required for IHC with this antibody?

Recommended antigen retrieval methods, where applicable, are listed on the datasheet under the IHC protocol section.