SV2A Antibody (Biotin)

Catalog number KB-126-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-126-01

Size / count 50 μL

Specifications

Catalog number: KB-126-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Synaptic vesicle glycoprotein 2A
Gene Name: SV2A
Gene ID: 9900
UniProt: Q7L0J3
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human SV2A
Target: PP-4515
Partner Proteins: Synaptic vesicle glycoprotein 2A
Clone: K70011_7D11
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 98%, Rat - 97%, Pig - 97%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: FIRGAKDIAKEVKKHAAKKVVKGLDRVQDEYSRRSYSRFEEEDDDDDFPAPSDGYYRGEGTQDEEEGGASSDATEGHDEDDEIYEGEYQGIPRAESGGKGERMADGAPLAGVRGGLSDGEGPPGGRGEAQRRKEREELAQQYEAILRECG
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 98%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: KIAA0736
Target Alternative Name: SV2A
Panel Description: Neuroscience Biomarkers
Host or Source: Mouse
Protein Name: Synaptic vesicle glycoprotein 2A
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for SV2A Antibody (Biotin)?

The catalog number for SV2A Antibody (Biotin) is KB-126.

What sizes are available for SV2A Antibody (Biotin)?

SV2A Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does SV2A Antibody (Biotin) come in?

SV2A Antibody (Biotin) is available in 3 different pack sizes.

Is SV2A Antibody (Biotin) in stock?

SV2A Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

What is the immunogen used to generate this antibody?

Immunogen or antigen details used to raise this antibody are listed on the product datasheet under immunogen information.

What is the recommended positive control for this assay?

A recommended positive control, where one is specified by the manufacturer, is listed on the datasheet or in the assay protocol.

How should this product be stored?

Storage conditions depend on the specific reagent and are listed on the product datasheet, with most antibodies and proteins requiring -20°C unless stated otherwise. It is your responsibility to store the product correctly immediately upon receipt; damage from improper storage after delivery is not eligible for replacement.

All Products