SV2A Antibody (Biotin)

Catalog number KB-8338-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-8338-01

Size / count 50 μL

Specifications

Catalog number: KB-8338-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Synaptic vesicle glycoprotein 2A
Gene Name: SV2A
Gene ID: 9900
UniProt: Q7L0J3
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human SV2A
Target: PP-4515
Partner Proteins: Synaptic vesicle glycoprotein 2A
Clone: K70011_15A2
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 98%, Rat - 97%, Pig - 97%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: FIRGAKDIAKEVKKHAAKKVVKGLDRVQDEYSRRSYSRFEEEDDDDDFPAPSDGYYRGEGTQDEEEGGASSDATEGHDEDDEIYEGEYQGIPRAESGGKGERMADGAPLAGVRGGLSDGEGPPGGRGEAQRRKEREELAQQYEAILRECG
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 98%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: KIAA0736
Target Alternative Name: SV2A
Panel Description: Neuroscience Biomarkers
Host or Source: Mouse
Protein Name: Synaptic vesicle glycoprotein 2A
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for SV2A Antibody (Biotin)?

The catalog number for SV2A Antibody (Biotin) is KB-8338.

What sizes are available for SV2A Antibody (Biotin)?

SV2A Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does SV2A Antibody (Biotin) come in?

SV2A Antibody (Biotin) is available in 3 different pack sizes.

Is SV2A Antibody (Biotin) in stock?

SV2A Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

Is this antibody conjugated?

Conjugation status, such as unconjugated, HRP, FITC, or biotin, is specified in the product name and confirmed on the datasheet.

What is the sensitivity of this ELISA kit?

Assay sensitivity, including the minimum detectable dose, is listed on the datasheet. Kits that are assembled on order typically ship within 2-4 weeks.

Do you ship this product with dry ice?

Some products, including certain cell lines and biologics, require dry ice for transportation, which carries an additional fee shown clearly in your quotation. Dry ice delivery isn’t always possible to every destination due to transit time or local restrictions, so we check feasibility in advance and you must store the goods at the correct temperature the moment they arrive.