Recombinant DNAH12 Antibody

Catalog number RN-13754-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-13754-01

Size / count 50 μL

Specifications

Catalog number: RN-13754-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Dynein axonemal heavy chain 12, Axonemal beta dynein heavy chain 12, Axonemal dynein heavy chain 12-like protein, Axonemal dynein heavy chain 7-like protein, Ciliary dynein heavy chain 12, Dynein axonemal heavy chain 7-like, Dynein heavy chain domain-containing protein 2
Gene Name: DNAH12
Gene ID: 201625
UniProt: Q6ZR08
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human DNAH12
Target: PP-6763
Partner Proteins: Dynein axonemal heavy chain 12; Axonemal beta dynein heavy chain 12; Axonemal dynein heavy chain 12-like protein; Axonemal dynein heavy chain 7-like protein; Ciliary dynein heavy chain 12; Dynein axonemal heavy chain 7-like; Dynein heavy chain domain-containing protein 2
Clone: K40100_3A8
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 94%, Rat - 92%, Pig - 97%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: DELIENAKHKKENELMAKREKLILEIEKESRRMEEFTEFAELERMQQYVTDVRQLQKRIQESEEAVQFINKEEELFKWELTKYPELDKLKVNIEPYQKFFNFVLKWQRSEKRWMDGGFLD
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 94%
Recombinant Antibody: Yes
IHC Dilution: 1:500
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: DHC3; DLP12; DNAH12L; DNAH7L; DNAHC3; DNHD2; HDHC3; HL19
Target Alternative Name: DNAH12
Host or Source: Mouse
Protein Name: Dynein axonemal heavy chain 12
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant DNAH12 Antibody?

The catalog number for Recombinant DNAH12 Antibody is RN-13754.

What sizes are available for Recombinant DNAH12 Antibody?

Recombinant DNAH12 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant DNAH12 Antibody come in?

Recombinant DNAH12 Antibody is available in 3 different pack sizes.

Is Recombinant DNAH12 Antibody in stock?

Recombinant DNAH12 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Do you offer custom or private-label production of this type of product?

Yes, custom antibody development and private-label production services are available. Contact our sales team to discuss your target, timeline, and quantity requirements.

What is the immunogen used to generate this antibody?

Immunogen or antigen details used to raise this antibody are listed on the product datasheet under immunogen information.

What is the recommended positive control for this assay?

A recommended positive control, where one is specified by the manufacturer, is listed on the datasheet or in the assay protocol.