CHRDL2 Antibody (Biotin)

Catalog number KB-8102-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-8102-01

Size / count 50 μL

Specifications

Catalog number: KB-8102-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Chordin-like protein 2, Breast tumor novel factor 1, BNF-1, Chordin-related protein 2
Gene Name: CHRDL2
Gene ID: 25884
UniProt: Q6WN34
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CHRDL2
Target: PQ-183
Partner Proteins: Chordin-like protein 2; Breast tumor novel factor 1; BNF-1; Chordin-related protein 2
Clone: K1E064_12D2
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 73%, Rat - 40%, Pig - 89%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: RARPDMFCLFHGKRYSPGESWHPYLEPQGLMYCLRCTCSEGAHVSCYRLHCPPVHCPQPVTEPQQCCPKCVEPHTPSGLRAPPKSCQHNGTMYQHGEIFSAHELFPSRLPNQCVLCSCTEGQIYCGLTTCPEPGCPAPLPLPDSCCQACKDEASEQSDEEDSVQSLHGVRHPQDPCSSDAGRKRGPGTPAPTGLSAPLSFIPRHFRPKGAGSTTVKIVLKEKHKKACVHGGKTYSHGEVWHPAFRAFGPLPCILCTCEDGRQDCQRVTCPTEYPCRHPEKVAGKCCKICPEDKADPGHSEISSTRCPKAPGRVLVHTSVSPSPDNLRRFALEHEASDLVEIYLWKLVKGIFHLTQIKKVRKQDFQKEAQHFRLLAGPHEGHWNVFLAQTLELKVTASPDKVTKT
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 73%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: BNF1; CHL2
Target Alternative Name: CHRDL2
Host or Source: Mouse
Protein Name: Chordin like 2
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for CHRDL2 Antibody (Biotin)?

The catalog number for CHRDL2 Antibody (Biotin) is KB-8102.

What sizes are available for CHRDL2 Antibody (Biotin)?

CHRDL2 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does CHRDL2 Antibody (Biotin) come in?

CHRDL2 Antibody (Biotin) is available in 3 different pack sizes.

Is CHRDL2 Antibody (Biotin) in stock?

CHRDL2 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

Can you help me confirm if this product is right for my specific experiment?

Yes, contact us with details of your sample type, species, and intended application, and our specialists will confirm suitability or suggest an alternative from our supplier network if this isn’t the best fit.

What is the purity of this recombinant protein?

Purity, typically assessed by SDS-PAGE, is listed on the datasheet under quality control data.

What do I do if this product arrives with reduced ice or a damaged cold-chain package?

Report this to us immediately with photos and your order reference. Our specialists will assess whether the product is still usable given the cold-chain interruption, and will arrange a replacement or credit if it isn’t.