CXCL17 Antibody (HRP)

Catalog number KH-2116-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KH-2116-01

Size / count 50 μL

Specifications

Catalog number: KH-2116-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: C-X-C motif chemokine 17, 6-Cys CXCL17, Dendritic cell and monocyte chemokine-like protein, DMC, VEGF coregulated chemokine 1) [Cleaved into: 4-Cys CXCL17]
Gene Name: CXCL17
Gene ID: 284340
UniProt: Q6UXB2
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CXCL17
Target: PP-1553
Partner Proteins: C-X-C motif chemokine 17; 6-Cys CXCL17; Dendritic cell and monocyte chemokine-like protein; DMC; VEGF coregulated chemokine 1) [Cleaved into: 4-Cys CXCL17]
Clone: K52038_2E4
Conjugation: Conjugated with peroxidase
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 72%, Pig - 80%, Cynomolgus monkey - 95%
Purity: ≥85%
Cores: GHRDRGQASRRWLQEGGQECECKDWFLRAPRRKFMTVSGLPKKQCPCDHFKGNVKKTRHQRHHRKPNKHSRACQQFLKQC
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 72%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:250~1:500
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: VCC1
Target Alternative Name: CXCL17
Panel Description: Cytokines
Host or Source: Mouse
Protein Name: C-X-C motif chemokine ligand 17
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2b

Frequently Asked Questions

What is the catalog number for CXCL17 Antibody (HRP)?

The catalog number for CXCL17 Antibody (HRP) is KH-2116.

What sizes are available for CXCL17 Antibody (HRP)?

CXCL17 Antibody (HRP) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does CXCL17 Antibody (HRP) come in?

CXCL17 Antibody (HRP) is available in 3 different pack sizes.

Is CXCL17 Antibody (HRP) in stock?

CXCL17 Antibody (HRP) is currently made to order / not held in immediate stock. Contact us for lead time.

Is antigen retrieval required for IHC with this antibody?

Recommended antigen retrieval methods, where applicable, are listed on the datasheet under the IHC protocol section.

What temperature does this product ship at?

Shipping temperature is chosen based on the product’s stability needs, ranging from ambient to dry ice, and is indicated on the product page. Any related shipping fee is shown clearly in your quotation.

What is the molecular weight of the target protein?

Molecular weight information, where applicable, is listed on the datasheet under target details, useful for confirming the correct band on western blot.

All Products