RICTOR Antibody (Biotin)

Catalog number KB-2751-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-2751-01

Size / count 50 μL

Specifications

Catalog number: KB-2751-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Rapamycin-insensitive companion of mTOR, AVO3 homolog, hAVO3
Gene Name: RICTOR
Gene ID: 253260
UniProt: Q6R327
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human RICTOR
Target: PP-1078
Partner Proteins: Rapamycin-insensitive companion of mTOR; AVO3 homolog; hAVO3
Clone: K9N011_2F8
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 87%, Pig - 95%, Cynomolgus monkey - 96%
Purity: ≥85%
Cores: TFYDRSGPIKDKNSFPFFASSKLVKNRILNSLTLPNKKHRSSSDPKGGKLSSESKTSNRRIRTLTEPSVDFNHSDDFTPISTVQKTLQLE
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 87%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: KIAA1999
Target Alternative Name: RICTOR
Panel Description: E3 Ligase, Ferroptosis, Ubiquitin-Proteasome System
Host or Source: Mouse
Protein Name: RPTOR independent companion of MTOR complex 2
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for RICTOR Antibody (Biotin)?

The catalog number for RICTOR Antibody (Biotin) is KB-2751.

What sizes are available for RICTOR Antibody (Biotin)?

RICTOR Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does RICTOR Antibody (Biotin) come in?

RICTOR Antibody (Biotin) is available in 3 different pack sizes.

Is RICTOR Antibody (Biotin) in stock?

RICTOR Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

What buffer is this product supplied in?

The formulation or storage buffer is listed on the product datasheet. If you require a carrier-free or custom formulation, contact us before ordering, as this may involve a made-to-order production timeline.

What dilution range is recommended for immunohistochemistry (IHC) with this antibody?

A starting IHC dilution range is listed on the datasheet, but should be optimized for your specific tissue type and staining protocol.

Can I request a Safety Data Sheet (SDS) for this product?

Yes, safety data sheets are available for hazardous or chemically classified products and can be provided on request or downloaded from the product page.