RICTOR Antibody (Biotin)

Catalog number KB-2532-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-2532-01

Size / count 50 μL

Specifications

Catalog number: KB-2532-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Rapamycin-insensitive companion of mTOR, AVO3 homolog, hAVO3
Gene Name: RICTOR
Gene ID: 253260
UniProt: Q6R327
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human RICTOR
Target: PP-1078
Partner Proteins: Rapamycin-insensitive companion of mTOR; AVO3 homolog; hAVO3
Clone: K9N011_8D10
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 87%, Pig - 95%, Cynomolgus monkey - 96%
Purity: ≥85%
Cores: TFYDRSGPIKDKNSFPFFASSKLVKNRILNSLTLPNKKHRSSSDPKGGKLSSESKTSNRRIRTLTEPSVDFNHSDDFTPISTVQKTLQLE
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 87%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: KIAA1999
Target Alternative Name: RICTOR
Panel Description: E3 Ligase, Ferroptosis, Ubiquitin-Proteasome System
Host or Source: Mouse
Protein Name: RPTOR independent companion of MTOR complex 2
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for RICTOR Antibody (Biotin)?

The catalog number for RICTOR Antibody (Biotin) is KB-2532.

What sizes are available for RICTOR Antibody (Biotin)?

RICTOR Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does RICTOR Antibody (Biotin) come in?

RICTOR Antibody (Biotin) is available in 3 different pack sizes.

Is RICTOR Antibody (Biotin) in stock?

RICTOR Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

What should I check when this product first arrives?

Inspect the package immediately for transportation damage, ice loss, leakage, or breakage. Report any issues right away with photos and your order reference; our specialists will determine whether the product is still usable or needs replacing.

Does this cell line or biologic require a Material Transfer Agreement (MTA)?

Some products, including certain cell lines, plasmids, and tissue cultures, are subject to intellectual property terms and may require an MTA before we can ship. We’ll inform you in advance if this product requires one, and additional handling fees may apply.

What should I do if I need to report a performance issue with a specific lot of this product?

Provide the catalogue number, product name, lot number, and your experimental results to our technical support team. They’ll investigate and, if needed, escalate to the manufacturer, provided the product was used before expiry and stored correctly.