Recombinant LIN9 Antibody

Catalog number RN-12404-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-12404-01

Size / count 50 μL

Specifications

Catalog number: RN-12404-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Protein lin-9 homolog, HuLin-9, hLin-9, Beta subunit-associated regulator of apoptosis, TUDOR gene similar protein, Type I interferon receptor beta chain-associated protein, pRB-associated protein
Gene Name: LIN9
Gene ID: 286826
UniProt: Q5TKA1
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human LIN9
Target: PP-10136
Partner Proteins: Protein lin-9 homolog; HuLin-9; hLin-9; Beta subunit-associated regulator of apoptosis; TUDOR gene similar protein; Type I interferon receptor beta chain-associated protein; pRB-associated protein
Clone: K1H007_15D2
Conjugation: Unconjugated
Applications: Top_IP/ChIP
Validation: Top_IP/ChIP
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 96%, Pig - 99%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: GLQPADQPTDMRRRCEEEAQEIVRHANSSTGQPCVENENLTDLISRLTAILLQIKCLAEGGDLNSFEFKSLTDSLNDIKSTIDASNISCF
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 96%
Recombinant Antibody: Yes
IP Dilution: 1:100
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: BARA; TGS
Target Alternative Name: LIN9
Host or Source: Mouse
Protein Name: Lin-9 DREAM MuvB core complex component
IP description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant LIN9 Antibody?

The catalog number for Recombinant LIN9 Antibody is RN-12404.

What sizes are available for Recombinant LIN9 Antibody?

Recombinant LIN9 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant LIN9 Antibody come in?

Recombinant LIN9 Antibody is available in 3 different pack sizes.

Is Recombinant LIN9 Antibody in stock?

Recombinant LIN9 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Do you provide a Certificate of Analysis (CoA) for this product?

A Certificate of Analysis is available for most products upon request. Contact our support team with the lot number to obtain the relevant CoA.

Is this product suitable for live cell imaging?

Suitability for live cell imaging depends on the specific reagent and conjugate used. Check the datasheet for imaging-specific validation, or contact us for guidance.

Is this product covered by a money-back guarantee?

Yes, we guarantee a full refund or store credit if this product arrives damaged beyond usability, or has a genuine performance issue under proper usage and storage, provided you report it immediately with evidence. Claims after the expiration date or due to improper storage after receipt are excluded.