DECR1 Antibody (Biotin)

Catalog number KB-8184-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-8184-01

Size / count 50 μL

Specifications

Catalog number: KB-8184-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: 2, 4-dienoyl-CoA reductase [ (3E) -enoyl-CoA-producing], mitochondrial, 2, 4-dienoyl-CoA reductase [NADPH], 4-enoyl-CoA reductase [NADPH], Short chain dehydrogenase/reductase family 18C member 1
Gene Name: DECR1
Gene ID: 1666
UniProt: Q16698
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human DECR1
Target: PP-1492
Partner Proteins: 2; 4-dienoyl-CoA reductase [ (3E) -enoyl-CoA-producing]; mitochondrial; 2; 4-dienoyl-CoA reductase [NADPH]; 4-enoyl-CoA reductase [NADPH]; Short chain dehydrogenase/reductase family 18C member 1
Clone: K1E041_4E6
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 85%, Rat - 85%, Pig - 90%, Cynomolgus monkey - 98%
Purity: ≥85%
Cores: NTEALQSKFFSPLQKAMLPPNSFQGKVAFITGGGTGLGKGMTTLLSSLGAQCVIASRKMDVLKATAEQISSQTGNKVHAIQCDVRDPDMVQNTVSELIKVAGHPNIVINNAAGNFISPTERLSPNAWKTITDIVLNGTAFVTLEIGKQLIKAQKGAAFLSITTIYAETGSGFVVPSASAKAGVEAMSKSLAAEWGKYGMRFNVIQPGPIKTKGAFSRLDPTGTFEKEMIGRIPCGRLGTVEELANLAAFLCSDYASWINGAVIKFDGGEEVLISGEFNDLRKVTKEQWDTIEELIRKTKGS
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 85%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: DECR; SDR18C1
Target Alternative Name: DECR1
Panel Description: Ferroptosis
Host or Source: Mouse
Protein Name: 2,4-Dienoyl-CoA reductase 1
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for DECR1 Antibody (Biotin)?

The catalog number for DECR1 Antibody (Biotin) is KB-8184.

What sizes are available for DECR1 Antibody (Biotin)?

DECR1 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does DECR1 Antibody (Biotin) come in?

DECR1 Antibody (Biotin) is available in 3 different pack sizes.

Is DECR1 Antibody (Biotin) in stock?

DECR1 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

What is the purity of this recombinant protein?

Purity, typically assessed by SDS-PAGE, is listed on the datasheet under quality control data.

What do I do if this product arrives with reduced ice or a damaged cold-chain package?

Report this to us immediately with photos and your order reference. Our specialists will assess whether the product is still usable given the cold-chain interruption, and will arrange a replacement or credit if it isn’t.

What host species was used to raise this antibody?

The host species used in production is listed under product specifications on the datasheet, and is relevant when selecting a compatible secondary antibody for your assay.