Extracellular Matrix Protein 1 Antibody

Catalog number KC-30959-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-30959-01

Size / count 50 μL

Specifications

Catalog number: KC-30959-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Extracellular matrix protein 1, Secretory component p85
Gene Name: ECM1
Gene ID: 1893
UniProt: Q16610
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human ECM1
Target: PP-514
Partner Proteins: Extracellular matrix protein 1; Secretory component p85
Clone: K56060_12H2
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 44%, Rat - 44%, Pig - 66%, Cynomolgus monkey - 94%
Purity: ≥85%
Cores: LSRSLPMDHPDSSQHGPPFEGQSQVQPPPSQEATPLQQEKLLPAQLPAEKEVGPPLPQEAVPLQKELPSLQHPNEQKEGTPAPFGDQSHPEPESWNAAQH
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 44%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:200~1:250
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: Extracellular Matrix Protein 1
Panel Description: Cytokines
Host or Source: Mouse
Protein Name: Extracellular matrix protein 1
WB Description: Fail (SK-MEL-28)
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Extracellular Matrix Protein 1 Antibody?

The catalog number for Extracellular Matrix Protein 1 Antibody is KC-30959.

What sizes are available for Extracellular Matrix Protein 1 Antibody?

Extracellular Matrix Protein 1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Extracellular Matrix Protein 1 Antibody come in?

Extracellular Matrix Protein 1 Antibody is available in 3 different pack sizes.

Is Extracellular Matrix Protein 1 Antibody in stock?

Extracellular Matrix Protein 1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What applications has this product been validated for?

Validated applications such as WB, ELISA, IHC, ICC, or FC are listed on the product datasheet. If you need application-specific validation data before ordering, contact our technical support team with the catalogue number.

How do I reconstitute this lyophilized product?

Reconstitution instructions, including the recommended diluent and final concentration, are provided on the datasheet. Aliquot immediately after reconstitution to avoid repeated freeze-thaw cycles.

What is the recommended incubation time for this antibody?

A suggested incubation time is provided in the recommended protocol on the datasheet, but may need adjusting depending on your sample type and detection system.