Recombinant Extracellular Matrix Protein 1 Antibody — image 1 of 2

Product details

Recombinant Extracellular Matrix Protein 1 Antibody

Catalog number RN-11124-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-11124-01

Size / count 50 μL

Specifications

Catalog number: RN-11124-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Extracellular matrix protein 1, Secretory component p85
Gene Name: ECM1
Gene ID: 1893
UniProt: Q16610
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human ECM1
Target: PP-514
Partner Proteins: Extracellular matrix protein 1; Secretory component p85
Clone: K56060_5A6
Conjugation: Unconjugated
Applications: Top_IHC&Top_WB
Validation: Top_IHC&Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 44%, Rat - 44%, Pig - 66%, Cynomolgus monkey - 94%
Purity: ≥85%
Cores: LSRSLPMDHPDSSQHGPPFEGQSQVQPPPSQEATPLQQEKLLPAQLPAEKEVGPPLPQEAVPLQKELPSLQHPNEQKEGTPAPFGDQSHPEPESWNAAQH
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 44%
Recombinant Antibody: Yes
IHC Dilution: 1:100~1:200
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: Extracellular Matrix Protein 1
Panel Description: Cytokines
Host or Source: Mouse
Protein Name: Extracellular matrix protein 1
WB Description: Succeed
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant Extracellular Matrix Protein 1 Antibody?

The catalog number for Recombinant Extracellular Matrix Protein 1 Antibody is RN-11124.

What sizes are available for Recombinant Extracellular Matrix Protein 1 Antibody?

Recombinant Extracellular Matrix Protein 1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant Extracellular Matrix Protein 1 Antibody come in?

Recombinant Extracellular Matrix Protein 1 Antibody is available in 3 different pack sizes.

Is Recombinant Extracellular Matrix Protein 1 Antibody in stock?

Recombinant Extracellular Matrix Protein 1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the recommended dilution for this antibody?

A recommended dilution range for each validated application is provided on the datasheet, but optimal dilution should be titrated for your specific experimental system, sample type, and detection method.

What is the recommended storage temperature after reconstitution?

Post-reconstitution storage guidance is listed on the datasheet, typically requiring aliquoting and storage at -20°C or -80°C to preserve activity.

Can this product be used in multiplex assays?

Multiplex compatibility depends on the specific product and detection panel. Contact our technical support team with details of your multiplex system for guidance before ordering.