IL17A Antibody (Biotin)

Catalog number KB-3000-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-3000-01

Size / count 50 μL

Specifications

Catalog number: KB-3000-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Interleukin-17A, IL-17, IL-17A, Cytotoxic T-lymphocyte-associated antigen 8, CTLA-8
Gene Name: IL17A
Gene ID: 3605
UniProt: Q16552
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human IL17A
Target: PQ-368
Partner Proteins: Interleukin-17A; IL-17; IL-17A; Cytotoxic T-lymphocyte-associated antigen 8; CTLA-8
Clone: K1E007_1C3
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 62%, Rat - 60%, Pig - 75%, Cynomolgus monkey - 95%
Purity: ≥85%
Cores: GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 62%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: CTLA8; IL17
Target Alternative Name: IL17A
Panel Description: Cytokines, Neuroscience Biomarkers, Ferroptosis
Host or Source: Mouse
Protein Name: Interleukin 17A
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2b

Frequently Asked Questions

What is the catalog number for IL17A Antibody (Biotin)?

The catalog number for IL17A Antibody (Biotin) is KB-3000.

What sizes are available for IL17A Antibody (Biotin)?

IL17A Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does IL17A Antibody (Biotin) come in?

IL17A Antibody (Biotin) is available in 3 different pack sizes.

Is IL17A Antibody (Biotin) in stock?

IL17A Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

Do you offer bulk or custom quantities of this product?

Yes. Ordering two or more units, or combining this with other products, usually qualifies for a discount depending on quantity. Contact our sales team with your required volume for a custom quote.

Do you provide a Certificate of Analysis (CoA) for this product?

A Certificate of Analysis is available for most products upon request. Contact our support team with the lot number to obtain the relevant CoA.

Is this product suitable for live cell imaging?

Suitability for live cell imaging depends on the specific reagent and conjugate used. Check the datasheet for imaging-specific validation, or contact us for guidance.