ERBB4 Antibody (Biotin)

Catalog number KB-2501-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-2501-01

Size / count 50 μL

Specifications

Catalog number: KB-2501-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Receptor tyrosine-protein kinase erbB-4, Proto-oncogene-like protein c-ErbB-4, Tyrosine kinase-type cell surface receptor HER4, p180erbB4) [Cleaved into: ERBB4 intracellular domain, 4ICD, E4ICD, s80HER4]
Gene Name: ERBB4
Gene ID: 2066
UniProt: Q15303
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human ERBB4
Target: PP-1056
Partner Proteins: Receptor tyrosine-protein kinase erbB-4; Proto-oncogene-like protein c-ErbB-4; Tyrosine kinase-type cell surface receptor HER4; p180erbB4) [Cleaved into: ERBB4 intracellular domain; 4ICD; E4ICD; s80HER4]
Clone: K16284_4A3
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 92%, Rat - 89%, Pig - 96%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: FAAEQGVSVPYRAPTSTIPEAPVAQGATAEIFDDSCCNGTLRKPVAPHVQEDSSTQRYSADPTVFAPERSPRGELDEEGYMTPMRDKPKQEYLNPVEENPFVSRRKNGDLQALDNPEYHN
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 92%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: HER4
Target Alternative Name: ERBB4
Panel Description: Neurodegenerative Diseases Marker
Host or Source: Mouse
Protein Name: Erb-b2 receptor tyrosine kinase 4
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

How do I request a quotation for this product?

Add the product and required quantity to your cart, then submit the quotation request from the checkout page. Include your contact and delivery details so the Afraxis team can respond.

How can I identify the product or variant I need?

Check the product description, specifications and catalogue number on this page. If the product has multiple variants, select the required catalogue number and size before adding it to your cart.

Where can I find product documentation?

Available product documents are listed in the Product documents section on this page. If a document you need is not listed, contact Afraxis and include the product name and catalogue number.

How do I check the price and availability?

The product page shows the available variant and any displayed price information. For a quotation or confirmation for your order, add the product to your cart and submit a request.

How long will delivery take?

Delivery timing depends on the product, supplier and destination. Request a quotation with your delivery details to confirm the expected timing for your order.

Does this product require special handling or shipping?

Review any product-specific handling details shown on this page. If you are unsure about storage or shipping requirements, contact Afraxis with the product name and catalogue number.

Who can use Afraxis products?

Afraxis products are supplied for laboratory and research use. Review the product documentation and intended-use information before use.

How do I contact Afraxis about this product?

Use the contact form or contact details on the Afraxis website. Include the product name and catalogue number so the team can assist with your enquiry.