Caspase-8 Antibody (Biotin)

Catalog number KB-3673-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-3673-01

Size / count 50 μL

Specifications

Catalog number: KB-3673-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Caspase-8, CASP-8, Apoptotic cysteine protease, Apoptotic protease Mch-5, CAP4, FADD-homologous ICE/ced-3-like protease, FADD-like ICE, FLICE, ICE-like apoptotic protease 5, MORT1-associated ced-3 homolog, MACH) [Cleaved into: Caspase-8 subunit p18, Caspase-8 subunit p10]
Gene Name: CASP8
Gene ID: 841
UniProt: Q14790
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CASP8
Target: P00536PAD
Partner Proteins: Caspase-8; CASP-8; Apoptotic cysteine protease; Apoptotic protease Mch-5; CAP4; FADD-homologous ICE/ced-3-like protease; FADD-like ICE; FLICE; ICE-like apoptotic protease 5; MORT1-associated ced-3 homolog; MACH) [Cleaved into: Caspase-8 subunit p18; Caspase-8 subunit p10]
Clone: K29071_20A1
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 68%, Rat - 68%, Pig - 63%, Cynomolgus monkey - 89%
Purity: ≥85%
Cores: TTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQF
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 68%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: MCH5
Target Alternative Name: Caspase-8
Panel Description: Neurodegenerative Diseases Marker
Host or Source: Mouse
Protein Name: Caspase 8
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Caspase-8 Antibody (Biotin)?

The catalog number for Caspase-8 Antibody (Biotin) is KB-3673.

What sizes are available for Caspase-8 Antibody (Biotin)?

Caspase-8 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Caspase-8 Antibody (Biotin) come in?

Caspase-8 Antibody (Biotin) is available in 3 different pack sizes.

Is Caspase-8 Antibody (Biotin) in stock?

Caspase-8 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

What buffer is this product supplied in?

The formulation or storage buffer is listed on the product datasheet. If you require a carrier-free or custom formulation, contact us before ordering, as this may involve a made-to-order production timeline.

What dilution range is recommended for immunohistochemistry (IHC) with this antibody?

A starting IHC dilution range is listed on the datasheet, but should be optimized for your specific tissue type and staining protocol.

Can I request a Safety Data Sheet (SDS) for this product?

Yes, safety data sheets are available for hazardous or chemically classified products and can be provided on request or downloaded from the product page.